Property Summary

NCBI Gene PubMed Count 242
PubMed Score 636.58
PubTator Score 373.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.300 4.3e-03
atypical teratoid / rhabdoid tumor -1.600 6.7e-04
Breast cancer -3.000 1.3e-23
breast carcinoma -1.900 8.8e-05
glioblastoma -1.100 1.6e-05
group 3 medulloblastoma -1.700 5.5e-03
intraductal papillary-mucinous adenoma (... -1.400 1.1e-05
invasive ductal carcinoma -1.249 6.2e-03
lung adenocarcinoma -1.300 1.9e-03
lung cancer -1.300 8.5e-04
lung carcinoma -1.200 6.6e-07
medulloblastoma, large-cell -2.600 5.6e-05
ovarian cancer 1.200 5.4e-05
posterior fossa group B ependymoma -1.800 2.2e-08
primitive neuroectodermal tumor -1.300 7.4e-03
urothelial carcinoma -1.100 1.7e-03

Gene RIF (230)

AA Sequence

MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQH      1 - 70
RLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEP     71 - 140
TPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLW    141 - 210
AEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGP    211 - 280
GSMAHVSVVPVSSEGTPSREPVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLG    281 - 350
LLFCLGVAMFTYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV                           351 - 397
//

Text Mined References (245)

PMID Year Title