Property Summary

NCBI Gene PubMed Count 221
Grant Count 282
R01 Count 181
Funding $28,049,561.98
PubMed Score 588.62
PubTator Score 373.23

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P78423 O00672
Symbols NTN
NTT
CXC3
CXC3C
SCYD1
ABCD-3
C3Xkine
fractalkine
neurotactin

Gene

PDB

1B2T   1F2L   3ONA   4XT1   4XT3  

Gene RIF (214)

PMID Text
26796342 Cell proliferation enhancing and anti-apoptosis activity requires the intracellular domain and apparently the dimerization of the transmembrane chemokine ligand.
26718770 CX3CL1 increased the migration and invasiveness of DU145 and PC-3, causing epithelial-to-mesenchymal transition. TACE/TGF-alpha/EGFR pathway activation and Slug upregulation were responsible for this.
26633537 CX3CL1 was expressed only by the normal and cancer adjacent normal fallopian tube epithelium; its expression was largely lost in the malignant fallopian epithelium.
26632602 Suggest that CX3CL1 participates in cross-talk mechanisms between endothelium and other muscle tissue cells and may promote a shift in the microenvironment toward a more regenerative milieu after exercise.
26586708 Skin and serum CX3CL1 elevated expression was associated with psoriasis severity.
26558776 Fractalkine signaling regulates macrophage recruitment into the cochlea and promotes survival of spiral ganglion neurons.
26496926 FKN enhances cell proliferation by promoting cell cycle progression in hypoxic prostate cancer cells.
26191329 The interactions of CX3CL1, LEPR and IL-6 genes might increase the risk of coronary artery disease in Chinese Han population.
26168217 data suggest that fractalkine contributes to lymphocyte shifts, which may influence development of MVO through the action of effector T cells.
26080445 Data show that US28 receptor binds with high selectivity and improved binding for the CX3C chemokine, CX3CL1.
More...

AA Sequence

MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQH      1 - 70
RLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGESSSLEP     71 - 140
TPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLW    141 - 210
AEAKTSEAPSTQDPSTQASTASSPAPEENAPSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGP    211 - 280
GSMAHVSVVPVSSEGTPSREPVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLG    281 - 350
LLFCLGVAMFTYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV                           351 - 397
//

Text Mined References (224)

PMID Year Title
26796342 2016 Transmembrane chemokines act as receptors in a novel mechanism termed inverse signaling.
26718770 2016 CX3CL1 increases invasiveness and metastasis by promoting epithelial-to-mesenchymal transition through the TACE/TGF-?/EGFR pathway in hypoxic androgen-independent prostate cancer cells.
26633537 2015 Examination of the Fractalkine and Fractalkine Receptor Expression in Fallopian Adenocarcinoma Reveals Differences When Compared to Ovarian Carcinoma.
26632602 2016 CX3CL1--a macrophage chemoattractant induced by a single bout of exercise in human skeletal muscle.
26586708 2015 Elevated Local and Serum CX3CL1(Fractalkine) Expression and Its Association with Disease Severity in Patients with Psoriasis.
26558776 2015 Fractalkine Signaling Regulates Macrophage Recruitment into the Cochlea and Promotes the Survival of Spiral Ganglion Neurons after Selective Hair Cell Lesion.
26496926 2015 Upregulation of fractalkine contributes to theĀ proliferative response of prostate cancer cells to hypoxia via promoting the G1/S phase transition.
26191329 2015 Gene-gene interactions among CX3CL1, LEPR and IL-6 related to coronary artery disease in Chinese Han population.
26168217 2015 T lymphocytes and fractalkine contribute to myocardial ischemia/reperfusion injury in patients.
26080445 2015 Rationally designed chemokine-based toxin targeting the viral G protein-coupled receptor US28 potently inhibits cytomegalovirus infection in vivo.
More...