Property Summary

NCBI Gene PubMed Count 99
Grant Count 45
R01 Count 19
Funding $10,933,773.08
PubMed Score 570.52
PubTator Score 171.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.303 0.007
Multiple myeloma 1.178 0.008
astrocytic glioma -1.500 0.038
medulloblastoma -1.800 0.000
cystic fibrosis 1.244 0.000
medulloblastoma, large-cell -1.500 0.000
tuberculosis and treatment for 6 months -1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.134 0.013
lung cancer -1.700 0.001
ovarian cancer -2.200 0.000

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
1974 screening 3207 / 0 / 299548 Fluorescence polarization-based counterscreen for RBBP9 inhibitors: primary biochemical high throughput screening assay to identify inhibitors of the oxidoreductase glutathione S-transferase omega 1(GSTO1).
2175 summary 1 / 0 / 0 Summary of probe development efforts to identify inhibitors of the oxidoreductase glutathione S-transferase omega 1(GSTO1).
2176 screening 1286 / 0 / 1088 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of the oxidoreductase glutathione S-transferase omega 1(GSTO1).
449772 other 3 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of GSTO1: LC-MS/MS assay to assess binding of compounds to active site
463081 confirmatory 6 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of GSTO1: Gel-based activity-based protein profiling (ABPP) IC50
463093 other 0 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of the oxidoreductase glutathione S-transferase omega 1 (GSTO1): fluorescence-based click chemistry assay
463094 screening 10 / 0 / 10 Late stage assay provider results from the probe development effort to identify inhibitors of the oxidoreductase glutathione S-transferase omega 1 (GSTO1): fluorescence-based cell-based assay
463098 screening 22 / 0 / 60 Late stage assay provider results from the probe development effort to identify inhibitors of the oxidoreductase glutathione S-transferase omega 1 (GSTO1): gel-based activity-based protein profiling (ABPP) percent inhibition assay with endogenous enzyme
463101 other 2 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of the oxidoreductase glutathione S-transferase omega 1 (GSTO1): fluorescence-based click chemistry assay 2
463102 other 5 / 0 / 40 Late stage assay provider results from the probe development effort to identify inhibitors of the oxidoreductase glutathione S-transferase omega 1 (GSTO1): gel-based activity-based protein profiling (ABPP) selectivity assay with endogenous enzyme
More...

Gene RIF (95)

PMID Text
26354850 GSTP1 and GSTO1 polymorphisms are associated with epirubicin treatment outcomes as well as with epirubicin-related toxicity.
25726706 No significant association has been found between childhood Pre-B acute lymphoblastic leukemia and GSTO1 A140D and GSTO2 N142D polymorphisms.
25716313 Our results indicate that GSTO1*C/GSTO2*G haplotype is associated with increased risk of TCC. The modifying effect of GSTO2*G/G genotype on individual susceptibility to TCC is more pronounced, when associated with smoking.
25300926 This meta-analysis demonstrates that GSTO2 polymorphism may significantly increase cancer risk in Caucasian population and is associated with elevated risk of breast cancer; while GSTO1 polymorphism is not associated with cancer risk.
25103078 The present study provided epidemiological evidence for a significantly increased risk of UCB in ever smokers with the Ala/Ala genotype of the GSTO1 gene and the Arg/Arg genotype of the SULT1A1 gene.
25085586 Overexpression of GSTO1 is associated with esophageal squamous cell carcinoma.
24417908 Genetic variants in GSTO1 are associated with increased risk for recurrent miscarriage.
24040330 GSTT1 active genotype and GSTO1 Asp140Asp and GSTO2 Asp142Asp genotypes may have a prognostic/pharmacogenomic role in patients with muscle invasive bladder cancer.
23888047 The common A140D genetic polymorphism in GSTO1 was found to have significant effects on the kinetics of both the deglutathionylation and glutathionylation reactions.
23819933 Our study is the first to show that the frequency of GSTO1 A140D gene polymorphism in the Turkish population is similar to other Caucasian populations and that this polymorphism is not associated with susceptibility to NSCLC.
More...

AA Sequence

MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFG      1 - 70
LVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYA     71 - 140
GLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDP    141 - 210
TVSALLTSEKDWQGFLELYLQNSPEACDYGL                                           211 - 241
//

Text Mined References (107)

PMID Year Title
26354850 2015 GSTP1 and GSTO1 single nucleotide polymorphisms and the response of bladder cancer patients to intravesical chemotherapy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25726706 2015 Childhood Pre-B acute lymphoblastic leukemia and glutathione S-transferase omega 1 and 2 polymorphisms.
25716313 2015 GSTO1*C/GSTO2*G haplotype is associated with risk of transitional cell carcinoma of urinary bladder.
25300926 2014 Genetic polymorphisms in Glutathione S-transferase Omega (GSTO) and cancer risk: a meta-analysis of 20 studies.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
25103078 2014 Combined effects of GSTO1 and SULT1A1 polymorphisms and cigarette smoking on urothelial carcinoma risk in a Taiwanese population.
25085586 2014 Identification of glutathione S-transferase omega 1 (GSTO1) protein as a novel tumor-associated antigen and its autoantibody in human esophageal squamous cell carcinoma.
24417908 2014 GSTO1 uncommon genetic variants are associated with recurrent miscarriage risk.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...