Property Summary

Ligand Count 2
NCBI Gene PubMed Count 102
PubMed Score 598.31
PubTator Score 171.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.500 3.8e-02
cystic fibrosis 1.244 2.2e-05
group 4 medulloblastoma -1.500 4.9e-04
lung cancer -1.700 6.4e-04
medulloblastoma, large-cell -1.400 2.2e-03
Multiple myeloma 1.178 7.5e-03
ovarian cancer -2.200 3.2e-07
pancreatic ductal adenocarcinoma liver m... -1.134 1.3e-02
tuberculosis and treatment for 6 months -1.200 8.5e-06
Waldenstrons macroglobulinemia 1.303 6.7e-03

Gene RIF (98)

AA Sequence

MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKPEWFFKKNPFG      1 - 70
LVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELFSKVPSLVGSFIRSQNKEDYA     71 - 140
GLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPWFERLEAMKLNECVDHTPKLKLWMAAMKEDP    141 - 210
TVSALLTSEKDWQGFLELYLQNSPEACDYGL                                           211 - 241
//

Text Mined References (110)

PMID Year Title