Property Summary

NCBI Gene PubMed Count 9
Grant Count 13
R01 Count 5
Funding $2,195,228.25
PubMed Score 39.29
PubTator Score 31.36

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
25512384 Strategies to pharmacologically regulate Irx3 function in adult endothelial cells may provide new therapies for angiogenesis.
24646999 data suggest that IRX3 is a functional long-range target of obesity-associated variants within FTO and represents a novel determinant of body mass and composition
20080751 IRX3 function may have a direct functional relationship to both obesity and type 2 diabetes.
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSFPQLGYQYIRPLYPSERPGAAGGSGGSAGARGGLGAGASELNASGSLSNVLSSVYGAPYAAAAAAAAA      1 - 70
QGYGAFLPYAAELPIFPQLGAQYELKDSPGVQHPAAAAAFPHPHPAFYPYGQYQFGDPSRPKNATRESTS     71 - 140
TLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRSRTDEEGNAYGSER    141 - 210
EEEDEEEDEEDGKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDL    211 - 280
GLGPISDSKNSDSEDSSEGLEDRPLPVLSLAPAPPPVAVASPSLPSPPVSLDPCAPAPAPASALQKPKIW    281 - 350
SLAETATSPDNPRRSPPGAGGSPPGAAVAPSALQLSPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGP    351 - 420
RLHPLSLLGSAPPHLLGLPGAAGHPAAAAAFARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPQNHLD    421 - 490
AALVLSALSSS                                                               491 - 501
//

Text Mined References (9)

PMID Year Title
25512384 2015 The proangiogenic effect of iroquois homeobox transcription factor Irx3 in human microvascular endothelial cells.
24646999 2014 Obesity-associated variants within FTO form long-range functional connections with IRX3.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
20080751 2010 Long-range gene regulation links genomic type 2 diabetes and obesity risk regions to HHEX, SOX4, and IRX3.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10370142 1999 Regulated expression patterns of IRX-2, an Iroquois-class homeobox gene, in the human breast.
9427753 1998 Xiro3 encodes a Xenopus homolog of the Drosophila Iroquois genes and functions in neural specification.