Property Summary

NCBI Gene PubMed Count 13
PubMed Score 44.77
PubTator Score 31.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.347 1.1e-02
aldosterone-producing adenoma -1.051 9.6e-03
astrocytic glioma 1.400 3.9e-02
atypical teratoid / rhabdoid tumor 2.100 8.2e-03
Breast cancer -1.100 2.3e-05
breast carcinoma 1.400 4.8e-02
cystic fibrosis 2.996 2.4e-07
ductal carcinoma in situ 1.500 1.1e-02
Endometriosis -1.295 3.2e-02
ependymoma 2.100 2.3e-02
glioblastoma 2.500 3.5e-04
intraductal papillary-mucinous adenoma (... -2.900 1.5e-03
intraductal papillary-mucinous neoplasm ... -3.300 7.8e-03
medulloblastoma 1.600 1.3e-02
oligodendroglioma 1.900 6.4e-03
ovarian cancer -2.100 1.3e-02
pediatric high grade glioma 2.000 9.4e-04
pituitary cancer -1.300 5.4e-05
primitive neuroectodermal tumor 1.900 1.8e-02
spina bifida -1.181 4.7e-02

Gene RIF (8)

AA Sequence

MSFPQLGYQYIRPLYPSERPGAAGGSGGSAGARGGLGAGASELNASGSLSNVLSSVYGAPYAAAAAAAAA      1 - 70
QGYGAFLPYAAELPIFPQLGAQYELKDSPGVQHPAAAAAFPHPHPAFYPYGQYQFGDPSRPKNATRESTS     71 - 140
TLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRSRTDEEGNAYGSER    141 - 210
EEEDEEEDEEDGKRELELEEEELGGEEEDTGGEGLADDDEDEEIDLENLDGAATEPELSLAGAARRDGDL    211 - 280
GLGPISDSKNSDSEDSSEGLEDRPLPVLSLAPAPPPVAVASPSLPSPPVSLDPCAPAPAPASALQKPKIW    281 - 350
SLAETATSPDNPRRSPPGAGGSPPGAAVAPSALQLSPAAAAAAAHRLVSAPLGKFPAWTNRPFPGPPPGP    351 - 420
RLHPLSLLGSAPPHLLGLPGAAGHPAAAAAFARPAEPEGGTDRCSALEVEKKLLKTAFQPVPRRPQNHLD    421 - 490
AALVLSALSSS                                                               491 - 501
//

Text Mined References (13)

PMID Year Title