Property Summary

NCBI Gene PubMed Count 19
PubMed Score 29.78
PubTator Score 10.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 2.100 3.4e-03
Astrocytoma, Pilocytic 3.000 3.3e-06
Breast cancer -5.600 1.3e-24
breast carcinoma -2.600 3.5e-30
ependymoma 2.700 1.1e-04
glioblastoma 2.000 3.6e-02
Hydrolethalus syndrome -1.116 4.9e-02
invasive ductal carcinoma -2.600 1.1e-02
non primary Sjogren syndrome sicca 1.400 1.6e-02
oligodendroglioma 2.000 4.6e-03
pediatric high grade glioma 3.100 8.6e-04
primitive neuroectodermal tumor 2.800 3.3e-02
psoriasis -1.300 1.5e-06
sonic hedgehog group medulloblastoma 3.000 3.0e-03

Gene RIF (13)

AA Sequence

MSFPQLGYPQYLSAAGPGAYGGERPGVLAAAAAAAAAASSGRPGAAELGGGAGAAAVTSVLGMYAAAGPY      1 - 70
AGAPNYSAFLPYAADLSLFSQMGSQYELKDNPGVHPATFAAHTAPAYYPYGQFQYGDPGRPKNATRESTS     71 - 140
TLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSKDQEDGALFGSDT    141 - 210
EGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS    211 - 280
PLGLAKEAPEPGSTRLLSPGAAAGGLQGAPHGKPKIWSLAETATSPDGAPKASPPPPAGHPGAHGPSAGA    281 - 350
PLQHPAFLPSHGLYTCHIGKFSNWTNSAFLAQGSLLNMRSFLGVGAPHAAPHGPHLPAPPPPQPPVAIAP    351 - 420
GALNGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPSA              421 - 480
//

Text Mined References (19)

PMID Year Title