Property Summary

NCBI Gene PubMed Count 16
PubMed Score 25.61
PubTator Score 10.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Lung diseases 48
Disease Target Count P-value
psoriasis 6685 9.88450347212589E-38
breast carcinoma 1614 3.53205877599129E-30
Breast cancer 3099 1.33349672225453E-24
posterior fossa group B ependymoma 1530 4.5467102953991E-11
pilocytic astrocytoma 3086 3.85804912329174E-6
pediatric high grade glioma 2712 8.58322620337009E-4
glioblastoma 5572 0.00271263390158036
sonic hedgehog group medulloblastoma 1482 0.00297969958213134
astrocytic glioma 2241 0.00342468047417303
oligodendroglioma 2849 0.00461347665437357
invasive ductal carcinoma 2950 0.0110809398853708
non primary Sjogren syndrome sicca 840 0.0156394843156075
primitive neuroectodermal tumor 3031 0.0327304387023431
Hydrolethalus syndrome 128 0.0491523828186899
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Idiopathic scoliosis 29 3.031 1.5

Expression

  Differential Expression (14)

Synonym

Accession P78414 Q7Z2F8 Q8N312
Symbols IRX-5
IRXA1

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (11)

PMID Text
25822025 In osteosarcoma cells and lines, IRX1 overexpression was associated with hypomethylation of its own promoter. Experimental modulation in cell lines altered migration, invasion, and resistance to anoikis in vitro, and influenced lung metastasis in mice.
23456299 Findings suggest that methylation-associated down-regulation of EBF3 and IRX1 genes may play an important role in a pathogenic effect of TGF-beta on RASFs.
21649733 Helicobacter pylori infection contributes to IRX1 promoter methylation in gastric mucosa.
21602894 enforcing IRX1 expression effectively suppresses peritoneal spreading and pulmonary metastasis via anti-angiogenesis and anti-VM mechanisms, in addition to previously found cell growth and invasion.
20440264 IRX1 could potentially serve as a biomarker for gastric cancer.
20440264 Homeobox gene IRX1 is a tumor suppressor gene in gastric carcinoma.
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20029986 Results verify IRX1, EBF3, SLC5A8, SEPT9, and FUSSEL18 as valid methylation markers in two separate sets of HNSCC specimens; also preliminarily show a trend between HPV16 positivity and target gene hypermethylation of IRX1, EBF3, SLC5A8, and SEPT9.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18559491 Frequent methylation of IRX1 gene is associated with head and neck squamous cell carcinoma
More...

AA Sequence

MSFPQLGYPQYLSAAGPGAYGGERPGVLAAAAAAAAAASSGRPGAAELGGGAGAAAVTSVLGMYAAAGPY      1 - 70
AGAPNYSAFLPYAADLSLFSQMGSQYELKDNPGVHPATFAAHTAPAYYPYGQFQYGDPGRPKNATRESTS     71 - 140
TLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKVTWGARSKDQEDGALFGSDT    141 - 210
EGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDS    211 - 280
PLGLAKEAPEPGSTRLLSPGAAAGGLQGAPHGKPKIWSLAETATSPDGAPKASPPPPAGHPGAHGPSAGA    281 - 350
PLQHPAFLPSHGLYTCHIGKFSNWTNSAFLAQGSLLNMRSFLGVGAPHAAPHGPHLPAPPPPQPPVAIAP    351 - 420
GALNGDKASVRSSPTLPERDLVPRPDSPAQQLKSPFQPVRDNSLAPQEGTPRILAALPSA              421 - 480
//

Text Mined References (16)

PMID Year Title
25822025 2015 IRX1 hypomethylation promotes osteosarcoma metastasis via induction of CXCL14/NF-?B signaling.
23456299 2013 Hypermethylation of EBF3 and IRX1 genes in synovial fibroblasts of patients with rheumatoid arthritis.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
21649733 2011 Helicobacter pylori induces promoter hypermethylation and downregulates gene expression of IRX1 transcription factor on human gastric mucosa.
21602894 2011 IRX1 influences peritoneal spreading and metastasis via inhibiting BDKRB2-dependent neovascularization on gastric cancer.
20440264 2010 Homeobox gene IRX1 is a tumor suppressor gene in gastric carcinoma.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
20029986 2010 HPV status-independent association of alcohol and tobacco exposure or prior radiation therapy with promoter methylation of FUSSEL18, EBF3, IRX1, and SEPT9, but not SLC5A8, in head and neck squamous cell carcinomas.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18559491 2008 Frequently methylated tumor suppressor genes in head and neck squamous cell carcinoma.
More...