Property Summary

NCBI Gene PubMed Count 11
PubMed Score 16.76
PubTator Score 11.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Adenoid Cystic 99 0.0 0.0
Salivary Gland Neoplasms 46 0.0 0.0
Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count P-value
malignant mesothelioma 3232 2.1e-07
Breast cancer 3578 9.1e-06
cystic fibrosis 1696 4.2e-05
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.8
Prostate cancer 175 0.0 2.2
Disease Target Count Z-score Confidence
Idiopathic scoliosis 31 3.379 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer -1.300 9.1e-06
cystic fibrosis 1.100 4.2e-05
malignant mesothelioma 4.500 2.1e-07

Gene RIF (8)

AA Sequence

MSYPQFGYPYSSAPQFLMATNSLSTCCESGGRTLADSGPAASAQAPVYCPVYESRLLATARHELNSAAAL      1 - 70
GVYGGPYGGSQGYGNYVTYGSEASAFYSLNSFDSKDGSGSAHGGLAPAAAAYYPYEPALGQYPYDRYGTM     71 - 140
DSGTRRKNATRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWPP    141 - 210
RNKCADEKRPYAEGEEEEGGEEEAREEPLKSSKNAEPVGKEEKELELSDLDDFDPLEAEPPACELKPPFH    211 - 280
SLDGGLERVPAAPDGPVKEASGALRMSLAAGGGAALDEDLERARSCLRSAAAGPEPLPGAEGGPQVCEAK    281 - 350
LGFVPAGASAGLEAKPRIWSLAHTATAAAAAATSLSQTEFPSCMLKRQGPAAPAAVSSAPATSPSVALPH    351 - 420
SGALDRHQDSPVTSLRNWVDGVFHDPILRHSTLNQAWATAKGALLDPGPLGRSLGAGANVLTAPLARAFP    421 - 490
PAVPQDAPAAGAARELLALPKAGGKPFCA                                             491 - 519
//

Text Mined References (12)

PMID Year Title