Property Summary

NCBI Gene PubMed Count 7
Grant Count 2
R01 Count 2
Funding $191,000
PubMed Score 29.37
PubTator Score 1.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 0.000

AA Sequence

MSFPHFGHPYRGASQFLASASSSTTCCESTQRSVSDVASGSTPAPALCCAPYDSRLLGSARPELGAALGI      1 - 70
YGAPYAAAAAAQSYPGYLPYSPEPPSLYGALNPQYEFKEAAGSFTSSLAQPGAYYPYERTLGQYQYERYG     71 - 140
AVELSGAGRRKNATRETTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKM    141 - 210
TWAPKNKGGEERKAEGGEEDSLGCLTADTKEVTASQEARGLRLSDLEDLEEEEEEEEEAEDEEVVATAGD    211 - 280
RLTEFRKGAQSLPGPCAAAREGRLERRECGLAAPRFSFNDPSGSEEADFLSAETGSPRLTMHYPCLEKPR    281 - 350
IWSLAHTATASAVEGAPPARPRPRSPECRMIPGQPPASARRLSVPRDSACDESSCIPKAFGNPKFALQGL    351 - 420
PLNCAPCPRRSEPVVQCQYPSGAEAG                                                421 - 446
//

Text Mined References (8)

PMID Year Title
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11435706 2001 Cloning and chromosome mapping of human and chicken Iroquois (IRX) genes.
10370142 1999 Regulated expression patterns of IRX-2, an Iroquois-class homeobox gene, in the human breast.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.