Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.18
PubTator Score 13.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 1.0381353132223E-18
astrocytoma 1493 3.47216390090993E-12
pilocytic astrocytoma 3086 1.03917283298533E-11
juvenile dermatomyositis 1189 3.37789765800341E-11
posterior fossa group A ependymoma 1511 7.6757533466489E-10
ovarian cancer 8492 7.1961523254216E-9
oligodendroglioma 2849 6.63264778515365E-7
lung cancer 4473 2.07871077541387E-5
cutaneous lupus erythematosus 1056 0.00103508719333984
subependymal giant cell astrocytoma 2287 0.00120476105837552
nephrosclerosis 329 0.00124734738495695
adult high grade glioma 2148 0.00128111940209047
ulcerative colitis 2087 0.00140222100051216
glioblastoma 5572 0.00170122597460487
primary Sjogren syndrome 789 0.00184351562460378
limb girdle muscular dystrophy 2I 56 0.00191585457120522
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00668087973854261
active Crohn's disease 918 0.00707089534008242
tuberculosis 1563 0.0140261132206471
esophageal adenocarcinoma 737 0.0176010007179145

Expression

  Differential Expression (20)

Synonym

Accession P78410 B4DRT7 B4E103 F5H791 F8W6E0 O00477 O15338 O75658 Q76PA0 Q9BU81 Q9NR44
Symbols BTF4
BT3.2
CD277
BTN3.2

Gene

PANTHER Protein Class (2)

PDB

4F8Q  

Gene RIF (7)

PMID Text
25928882 BTN3A2 rs9104 was strongly associated with genotype 1 hepatitis C infection.
22966150 Three SNPs in BTN3A2 were associated with schizophrenia, rs12214031, rs9393709 and rs12199613. There was no interaction between these SNPs and HSV-1, CMV or toxoplasma exposure.
22685580 Results suggest that BT3.2 butyrophilin expression by epithelial cells may modulates the intratumoral infiltration of immune cells.
19571809 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19295542 our results identify PRSS16 and BTN3A2, two genes thought to play important roles in regulating the immune response, as potentially novel susceptibility genes for Type I Deabetes.
19295542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKMASSLAFLLLNFHVSLLLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS      1 - 70
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE     71 - 140
LKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIM    141 - 210
RGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWIAALAGTLPILLLLLAGASYFLWRQQKEITAL    211 - 280
SSEIESEQEMKEMGYAATEREISLRESLQEELKRKKIQYLTRGEESSSDTNKSA                    281 - 334
//

Text Mined References (21)

PMID Year Title
25928882 Fine-mapping butyrophilin family genes revealed several polymorphisms influencing viral genotype selection in hepatitis C infection.
22966150 2012 Evaluation of HLA polymorphisms in relation to schizophrenia risk and infectious exposure.
22846996 2012 The molecular basis for modulation of human V?9V?2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies.
22767497 2012 Key implication of CD277/butyrophilin-3 (BTN3A) in cellular stress sensing by a major human ?? T-cell subset.
22685580 2012 BTN3A2 expression in epithelial ovarian cancer is associated with higher tumor infiltrating T cells and a better prognosis.
21918970 2011 Differential role for CD277 as a co-regulator of the immune signal in T and NK cells.
21113407 2010 CD277 is a negative co-stimulatory molecule universally expressed by ovarian cancer microenvironmental cells.
20610803 2010 Stimulation of human butyrophilin 3 molecules results in negative regulation of cellular immunity.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...