Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.63
PubTator Score 13.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.332 7.1e-03
adult high grade glioma 2.100 1.3e-03
astrocytoma 1.700 3.5e-12
Astrocytoma, Pilocytic 3.300 8.5e-12
cutaneous lupus erythematosus 1.100 1.0e-02
ependymoma 1.600 3.4e-06
esophageal adenocarcinoma 1.500 1.8e-02
glioblastoma 1.900 2.8e-05
intraductal papillary-mucinous adenoma (... 1.200 6.7e-03
juvenile dermatomyositis 2.303 3.4e-11
limb girdle muscular dystrophy 2I 1.471 1.9e-03
lung cancer -1.100 6.1e-03
lung carcinoma -2.100 1.0e-18
nephrosclerosis 1.022 1.2e-03
oligodendroglioma 1.400 6.6e-07
ovarian cancer -1.700 1.8e-07
primary Sjogren syndrome 1.100 1.5e-02
subependymal giant cell astrocytoma 2.120 1.2e-03
tuberculosis 1.100 1.4e-02
ulcerative colitis 1.300 1.4e-03

Protein-protein Interaction (5)

Gene RIF (8)

AA Sequence

MKMASSLAFLLLNFHVSLLLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS      1 - 70
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE     71 - 140
LKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIM    141 - 210
RGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWIAALAGTLPILLLLLAGASYFLWRQQKEITAL    211 - 280
SSEIESEQEMKEMGYAATEREISLRESLQEELKRKKIQYLTRGEESSSDTNKSA                    281 - 334
//

Text Mined References (22)

PMID Year Title