Property Summary

NCBI Gene PubMed Count 19
PubMed Score 3.18
PubTator Score 13.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (7)

PMID Text
25928882 BTN3A2 rs9104 was strongly associated with genotype 1 hepatitis C infection.
22966150 Three SNPs in BTN3A2 were associated with schizophrenia, rs12214031, rs9393709 and rs12199613. There was no interaction between these SNPs and HSV-1, CMV or toxoplasma exposure.
22685580 Results suggest that BT3.2 butyrophilin expression by epithelial cells may modulates the intratumoral infiltration of immune cells.
19571809 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19295542 our results identify PRSS16 and BTN3A2, two genes thought to play important roles in regulating the immune response, as potentially novel susceptibility genes for Type I Deabetes.
19295542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKMASSLAFLLLNFHVSLLLVQLLTPCSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSS      1 - 70
SLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVE     71 - 140
LKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIM    141 - 210
RGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPWIAALAGTLPILLLLLAGASYFLWRQQKEITAL    211 - 280
SSEIESEQEMKEMGYAATEREISLRESLQEELKRKKIQYLTRGEESSSDTNKSA                    281 - 334
//

Text Mined References (21)

PMID Year Title
25928882 Fine-mapping butyrophilin family genes revealed several polymorphisms influencing viral genotype selection in hepatitis C infection.
22966150 2012 Evaluation of HLA polymorphisms in relation to schizophrenia risk and infectious exposure.
22846996 2012 The molecular basis for modulation of human V?9V?2 T cell responses by CD277/butyrophilin-3 (BTN3A)-specific antibodies.
22767497 2012 Key implication of CD277/butyrophilin-3 (BTN3A) in cellular stress sensing by a major human ?? T-cell subset.
22685580 2012 BTN3A2 expression in epithelial ovarian cancer is associated with higher tumor infiltrating T cells and a better prognosis.
21918970 2011 Differential role for CD277 as a co-regulator of the immune signal in T and NK cells.
21113407 2010 CD277 is a negative co-stimulatory molecule universally expressed by ovarian cancer microenvironmental cells.
20610803 2010 Stimulation of human butyrophilin 3 molecules results in negative regulation of cellular immunity.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...