Property Summary

NCBI Gene PubMed Count 77
Grant Count 45
R01 Count 37
Funding $3,676,558.87
PubMed Score 102.97
PubTator Score 82.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
astrocytic glioma -1.600 0.003
glioblastoma -1.400 0.043
oligodendroglioma -1.400 0.000
osteosarcoma -1.264 0.000
medulloblastoma -1.200 0.034
medulloblastoma, large-cell -1.900 0.010
cystic fibrosis 1.200 0.000
adult high grade glioma -1.200 0.043
pilocytic astrocytoma -2.400 0.000
posterior fossa group B ependymoma 2.000 0.000
ovarian cancer 1.800 0.004
non-small cell lung cancer 1.500 0.023
psoriasis 1.300 0.000
facioscapulohumeral dystrophy 4.000 0.000

Gene RIF (51)

PMID Text
26250467 The data showed that E7 induced CCNA1 methylation by forming a complex with Dnmt1 at the CCNA1 promoter, resulting in the subsequent reduction of expression in cancers.
25654082 These data from results indicated a significant connection of CCNA1 methylation with poor progression in human malignant tumors among both Caucasian and Asian populations.
25294903 DNA methylation status of key cell-cycle regulators such as CDKNA2/p16 and CCNA1 correlates with treatment response to doxorubicin and 5-fluorouracil in locally advanced breast tumors.
25292097 CCNA1 promoter methylation is associated with cervical squamous intraepithelial lesions.
25265349 High CCNA1 expression is associated with nasopharyngeal carcinoma.
25198553 HS3ST2 and CCNA1 genes may play important roles in HPV-induced cervical cancer and patients with specific hypermethylated genes may have a greater risk of progressing to invasive cervical cancer.
25173755 Mutations in genes such as AKT2, CCNA1, MAP3K4, and TGFBR1, were associated significantly with Epstein-Barr-positive gastric tumors, compared with EBV-negative tumors.
25039670 Cyclin A1 immunoexpression is of potential utility in predicting disease progression in patients with pT1 urothelial carcinomas of the bladder
24359512 presents CCNA1 and TIMP3 hypermethylation as a helpful tool to identify HNSCC subjects at risk of developing second primary carcinomas
24019929 Overexpression of cyclin A1 in FSHD indicates cell cycle dysregulation in FSHD and might contribute to clinical symptoms of this disease
More...

AA Sequence

METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILT      1 - 70
RAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMD     71 - 140
ELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTE    141 - 210
YAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMS    211 - 280
VLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQ    281 - 350
YLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV    351 - 420
PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ                             421 - 465
//

Text Mined References (81)

PMID Year Title
26250467 2015 Human papillomavirus type 16 E7 oncoprotein mediates CCNA1 promoter methylation.
25654082 2015 Correlation of CCNA1 promoter methylation with malignant tumors: a meta-analysis introduction.
25294903 2014 DNA methylation status of key cell-cycle regulators such as CDKNA2/p16 and CCNA1 correlates with treatment response to doxorubicin and 5-fluorouracil in locally advanced breast tumors.
25292097 2014 CCNA1 promoter methylation: a potential marker for grading Papanicolaou smear cervical squamous intraepithelial lesions.
25265349 2014 Elucidating the roles of miR-372 in cell proliferation and apoptosis of nasopharyngeal carcinoma TW01 cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25198553 2014 Methylation in the promoters of HS3ST2 and CCNA1 genes is associated with cervical cancer in Uygur women in Xinjiang.
25173755 2014 Integrative identification of Epstein-Barr virus-associated mutations and epigenetic alterations in gastric cancer.
25039670 2015 Cyclin A1 expression predicts progression in pT1 urothelial carcinoma of bladder: a tissue microarray study of 149 patients treated by transurethral resection.
24359512 2013 TIMP3 and CCNA1 hypermethylation in HNSCC is associated with an increased incidence of second primary tumors.
More...