Property Summary

NCBI Gene PubMed Count 79
PubMed Score 107.17
PubTator Score 82.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.200 4.3e-02
astrocytic glioma -1.600 3.3e-03
Astrocytoma, Pilocytic -2.400 5.0e-07
cystic fibrosis 1.200 4.3e-05
facioscapulohumeral dystrophy 2.000 1.3e-02
glioblastoma -1.300 2.4e-03
malignant mesothelioma -1.200 2.1e-05
medulloblastoma -1.200 3.4e-02
medulloblastoma, large-cell -1.900 9.5e-03
non-small cell lung cancer 1.500 2.3e-02
oligodendroglioma -1.400 2.3e-23
osteosarcoma -1.264 2.8e-04
ovarian cancer 1.800 4.4e-03
posterior fossa group B ependymoma 2.000 8.9e-06
psoriasis 1.300 8.3e-11

Gene RIF (53)

AA Sequence

METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILT      1 - 70
RAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMD     71 - 140
ELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTE    141 - 210
YAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMS    211 - 280
VLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQ    281 - 350
YLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIV    351 - 420
PCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ                             421 - 465
//

Text Mined References (83)

PMID Year Title