Property Summary

NCBI Gene PubMed Count 69
Grant Count 33
R01 Count 9
Funding $4,721,382.82
PubMed Score 194.00
PubTator Score 138.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 7.000 0.000
sonic hedgehog group medulloblastoma 2.500 0.001
atypical teratoid / rhabdoid tumor 3.600 0.000
medulloblastoma, large-cell 4.700 0.000
non-small cell lung cancer 2.577 0.000
lung cancer 2.200 0.000
lung adenocarcinoma 1.700 0.004
Breast cancer 2.300 0.007
ovarian cancer 2.200 0.000
psoriasis 1.700 0.000
facioscapulohumeral dystrophy 2.200 0.014

Gene RIF (56)

PMID Text
26823776 Our results suggest that the leukemias expressing high levels of PRAME has favorable prognosis
26044287 PRAME expression is considered as a poor prognostic parameter in HL.
25887863 PRAME immunoreactivity in myeloid leukemia (ML) of Down syndrome (DS) is largely due to the non-blast components, while PRAME immunoreactivity in blasts of Transient abnormal myelopoiesis (TAM) is not restricted to cases that progress to ML of DS.
24820636 This study shows the prognostic significance of PRAME expression in diffuse large B-cell lymphoma patients treated with R-CHOP therapy.
24600975 results suggested that PRAME was a predictor for better outcome, could be a useful target for immunotherapy, and might represent a candidate marker for the monitoring of minimal residual disease
23905893 elevated PRAME expression in head and neck squamous cell carcinoma
23460923 PRAME is upregulated by signalling pathways that are activated in response to infection/inflammation.
23460923 PRAME and its paralogs are leucine rich repeat proteins. Structure predictions suggest PRAME resembles the extracellular domains of TLR3 and TLR4, or intracellular NALP family. This suggests PRAME may have a role in sensing Pathogen Associated Molecular Patterns (PAMPs).
23460923 PRAME expression in leukaemic cell lines is upregulated by IFN gamma and LPS, suggesting a possible role in immune responses. PRAME associates with Elongin BC complexes by binding Elongin C, and co-localises to the Golgi network. Nuclear PRAME interacts with Histone H3. The results suggest that PRAME has dual roles in gene regulation in the nucleus and protein turnover trafficking in the Golgi
23444226 PRAME impairs differentiation and increases proliferation likely via blocking retinoic acid receptor signaling.
More...

AA Sequence

MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLK      1 - 70
AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNR     71 - 140
ASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCC    141 - 210
KKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEK    211 - 280
EEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQ    281 - 350
LSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI    351 - 420
SALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHC    421 - 490
GDRTFYDPEPILCPCFMPN                                                       491 - 509
//

Text Mined References (72)

PMID Year Title
26823776 2015 PRAME induces apoptosis and inhibits proliferation of leukemic cells in vitro and in vivo.
26044287 2015 PRAME Expression and Its Clinical Relevance in Hodgkin's Lymphoma.
25887863 2015 PRAME immunohistochemical staining in transient abnormal myelopoiesis and myeloid leukemia associated with Down syndrome.
24820636 2014 Prognostic significance of PRAME expression based on immunohistochemistry for diffuse large B-cell lymphoma patients treated with R-CHOP therapy.
24600975 2014 PRAME gene expression in childhood acute lymphoblastic leukemia: impact on prognosis.
23905893 2013 Elevated PRAME expression: what does this mean for treatment of head and neck squamous cell carcinoma?
23460923 2013 PRAME is a golgi-targeted protein that associates with the Elongin BC complex and is upregulated by interferon-gamma and bacterial PAMPs.
23444226 2013 PRAME-induced inhibition of retinoic acid receptor signaling-mediated differentiation--a possible target for ATRA response in AML without t(15;17).
23409080 2013 Knock-down of PRAME increases retinoic acid signaling and cytotoxic drug sensitivity of Hodgkin lymphoma cells.
23228130 2013 PRAME/EZH2-mediated regulation of TRAIL: a new target for cancer therapy.
More...