Property Summary

NCBI Gene PubMed Count 79
PubMed Score 220.56
PubTator Score 138.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 3.600 1.7e-05
Breast cancer 1.200 1.4e-02
facioscapulohumeral dystrophy 2.200 1.4e-02
group 3 medulloblastoma 1.600 8.4e-03
lung adenocarcinoma 1.700 4.3e-03
lung cancer 2.200 6.4e-05
malignant mesothelioma 7.000 1.3e-09
medulloblastoma, large-cell 4.700 1.2e-06
non-small cell lung cancer 2.577 1.0e-11
ovarian cancer 2.200 3.2e-04
psoriasis 1.700 4.3e-13

Gene RIF (66)

AA Sequence

MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLK      1 - 70
AMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNR     71 - 140
ASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCC    141 - 210
KKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEK    211 - 280
EEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQ    281 - 350
LSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGITDDQLLALLPSLSHCSQLTTLSFYGNSISI    351 - 420
SALQSLLQHLIGLSNLTHVLYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPHC    421 - 490
GDRTFYDPEPILCPCFMPN                                                       491 - 509
//

Text Mined References (82)

PMID Year Title