Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.66
PubTator Score 1.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.160 0.006
glioblastoma 1.100 0.011
pancreatic ductal adenocarcinoma liver m... -2.230 0.000
invasive ductal carcinoma 1.600 0.002
ovarian cancer 1.900 0.000

Synonym

Accession P78383 B4DEC4 J3KQV4 Q96EW7
Symbols UGTREL1

Gene

PANTHER Protein Class (1)

 GO Process (1)

Gene RIF (2)

PMID Text
22082156 Knockdown of solute carrier family 35, member B1 (SLC35B1) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20800603 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MASSSSLVPDRLRLPLCFLGVFVCYFYYGILQEKITRGKYGEGAKQETFTFALTLVFIQCVINAVFAKIL      1 - 70
IQFFDTARVDRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAK     71 - 140
YLCVLLIVAGVALFMYKPKKVVGIEEHTVGYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINL    141 - 210
WSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFT    211 - 280
ILASVILFANPISPMQWVGTVLVFLGLGLDAKFGKGAKKTSH                                281 - 322
//

Text Mined References (15)

PMID Year Title
23506892 Roles of the nucleotide sugar transporters (SLC35 family) in health and disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19270184 2009 The ortholog of human solute carrier family 35 member B1 (UDP-galactose transporter-related protein 1) is involved in maintenance of ER homeostasis and essential for larval development in Caenorhabditis elegans.
17113583 2006 Pan-genome isolation of low abundance transcripts using SAGE tag.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...