Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.16
PubTator Score 1.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.100 1.1e-02
invasive ductal carcinoma 1.600 1.7e-03
Multiple myeloma 1.160 5.6e-03
ovarian cancer 1.900 7.0e-05
pancreatic ductal adenocarcinoma liver m... -2.230 1.3e-04

 GO Process (1)

Gene RIF (2)

AA Sequence

MASSSSLVPDRLRLPLCFLGVFVCYFYYGILQEKITRGKYGEGAKQETFTFALTLVFIQCVINAVFAKIL      1 - 70
IQFFDTARVDRTRSWLYAACSISYLGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAK     71 - 140
YLCVLLIVAGVALFMYKPKKVVGIEEHTVGYGELLLLLSLTLDGLTGVSQDHMRAHYQTGSNHMMLNINL    141 - 210
WSTLLLGMGILFTGELWEFLSFAERYPAIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFT    211 - 280
ILASVILFANPISPMQWVGTVLVFLGLGLDAKFGKGAKKTSH                                281 - 322
//

Text Mined References (15)

PMID Year Title