Property Summary

NCBI Gene PubMed Count 19
Grant Count 266
R01 Count 154
Funding $42,474,931.76
PubMed Score 870.76
PubTator Score 22.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession P78381 A8K2L9 A8K9V1 B4DE11 B4DPT2 E7EW45 Q8IV21 Q92553
Symbols UGT
CDGX
UGAT
UGT1
UGT2
UGTL
CDG2M
UGALT
UDP-Gal-Tr

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
25944901 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
24115232 De novo mutations in SLC35A2 encoding a UDP-galactose transporter cause early-onset epileptic encephalopathy.
23583405 The data further supports the hypothesis that UGT and NGT cooperate in the UDP-Gal delivery for glycosyltransferases located in the Golgi apparatus.
23561849 Mosaicism of the UDP-galactose transporter SLC35A2 causes a congenital disorder of glycosylation.
21918738 localization of the UDP-Gal transporter may depend on the presence of the partner splice variant
18854154 Knockdown of solute carrier family 35 (UDP-galactose transporter), member A2 (SLC35A2) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTA      1 - 70
VVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAAT     71 - 140
FQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLDQNPGAGLAAVVASC    141 - 210
LSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAF    211 - 280
GGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIAS    281 - 350
ASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS                            351 - 396
//

Text Mined References (21)

PMID Year Title
25944901 2015 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
24115232 2013 De novo mutations in SLC35A2 encoding a UDP-galactose transporter cause early-onset epileptic encephalopathy.
23583405 2013 UDP-Gal/UDP-GlcNAc chimeric transporter complements mutation defect in mammalian cells deficient in UDP-Gal transporter.
23561849 2013 Mosaicism of the UDP-galactose transporter SLC35A2 causes a congenital disorder of glycosylation.
23089177 2012 UDP-N-acetylglucosamine transporter and UDP-galactose transporter form heterologous complexes in the Golgi membrane.
21918738 2011 Subcellular localization of UDP-GlcNAc, UDP-Gal and SLC35B4 transporters.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
More...