Property Summary

NCBI Gene PubMed Count 20
PubMed Score 934.50
PubTator Score 22.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE IIm 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 3.394 1.7

Expression

  Differential Expression (17)

Disease log2 FC p
Breast cancer 3.000 2.5e-02
ductal carcinoma in situ 1.400 1.9e-04
glioblastoma 1.100 6.5e-04
intraductal papillary-mucinous adenoma (... 1.200 3.5e-03
intraductal papillary-mucinous carcinoma... 1.500 6.9e-04
intraductal papillary-mucinous neoplasm ... 1.900 1.2e-03
invasive ductal carcinoma 1.500 1.1e-04
lung adenocarcinoma 1.200 9.8e-10
lung cancer -1.300 3.5e-03
malignant mesothelioma 1.400 6.1e-07
Multiple myeloma 1.393 1.9e-03
non-small cell lung cancer 1.093 2.8e-20
osteosarcoma -1.866 2.2e-05
ovarian cancer 2.500 1.2e-05
pituitary cancer -1.100 1.4e-03
psoriasis -1.600 9.6e-05
Rheumatoid arthritis -1.200 6.2e-03

Gene RIF (7)

AA Sequence

MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTA      1 - 70
VVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAAT     71 - 140
FQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLDQNPGAGLAAVVASC    141 - 210
LSSGFAGVYFEKILKGSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAF    211 - 280
GGLLVAVVVKYADNILKGFATSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIAS    281 - 350
ASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS                            351 - 396
//

Text Mined References (23)

PMID Year Title