Property Summary

NCBI Gene PubMed Count 230
Grant Count 61
R01 Count 42
Funding $5,559,936.17
PubMed Score 733.03
PubTator Score 509.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -1.779 0.028
glioblastoma 3.100 0.003
group 3 medulloblastoma -1.800 0.014
astrocytoma 2.000 0.023
medulloblastoma, large-cell -1.600 0.007
tuberculosis and treatment for 3 months -8.300 0.000
non-small cell lung cancer -3.336 0.000
lung cancer -5.900 0.000
colon cancer 1.600 0.047
pancreatic cancer 1.900 0.001
cystic fibrosis 1.400 0.000
lung adenocarcinoma -1.700 0.000
pediatric high grade glioma 1.800 0.003
pilocytic astrocytoma 2.300 0.000
invasive ductal carcinoma 3.698 0.000
lung carcinoma -5.300 0.000
breast carcinoma 1.100 0.000
mucosa-associated lymphoid tissue lympho... 2.979 0.023
ductal carcinoma in situ 1.200 0.005
psoriasis 2.700 0.000

Synonym

Accession P78380 A8K7V9 B4DI48 G3V1I4 Q2PP00 Q7Z484 Ox-LDL receptor 1
Symbols LOX1
LOXIN
SLOX1
CLEC8A
SCARE1

Gene

PDB

1YPO   1YPQ   1YPU   1YXJ   1YXK   3VLG  

Gene RIF (215)

PMID Text
26906623 The mechanistic link between miR-590-5p and LOX-1:miR-590-5p downregulation led to LOX-1 upregulation in endothelial cells.
26892134 Serum LAB was associated with an increased carotid IMT in Japanese men, especially those with hypercholesterolemia
26752047 rapamycin reduces mTOR phosphorylation and subsequently inhibit NF-kappaB activation and suppresses LOX-1, resulting in a reduction in ox-LDL uptake in HUVECs
26666837 the current meta-analysis highlighted that variant allele of OLR1 rs11053646 G > C and PCSK9 rs505151 A > G may contribute to the susceptibility risk of ischemic stroke.
26607724 Interaction between Lox-1, C-reactive protein and oxidized LDL play role in the pathogenesis of atherosclerosis.
26510581 Silencing of LOX-1 gene expression abolished ox-LDL induced effects in cell viability, reactive oxygen species generation and gene expression.
26495844 Cholesterol depletion triggers the release of LOX-1 in exosomes as a full-length transmembrane isoform and as a truncated ectodomain soluble fragment.
26305474 OLR1 is a novel molecular link between the proliferative and inflammatory responses of vascular smooth muscle cells.
26296941 for our Turkish sample group, LOX-1 30UTR188C/T and K167N polymorphisms may not be involved in susceptibility to GDM [gestational diabetes mellitus ]
26185381 The serum LOX-1 levels were significantly higher in NAFLD patients than in healthy controls.
More...

AA Sequence

MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE      1 - 70
QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC     71 - 140
SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN    141 - 210
PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ           211 - 273
//

Text Mined References (233)

PMID Year Title
26906623 2016 MiR-590-5p-meidated LOX-1 upregulation promotes Angiotensin II-induced endothelial cell apoptosis.
26892134 Serum level of LOX-1 ligand containing ApoB is associated with increased carotid intima-media thickness in Japanese community-dwelling men, especially those with hypercholesterolemia LOX-1 ligand and IMT in Japanese.
26752047 2016 Rapamycin Inhibits Oxidized Low Density Lipoprotein Uptake in Human Umbilical Vein Endothelial Cells via mTOR/NF-?B/LOX-1 Pathway.
26666837 2015 The Influence of OLR1 and PCSK9 Gene Polymorphisms on Ischemic Stroke: Evidence from a Meta-Analysis.
26607724 2016 Interplay between CRP, Atherogenic LDL, and LOX-1 and Its Potential Role in the Pathogenesis of Atherosclerosis.
26510581 2015 Modulation of oxidized-LDL receptor-1 (LOX1) contributes to the antiatherosclerosis effect of oleanolic acid.
26495844 2015 Membrane Cholesterol Modulates LOX-1 Shedding in Endothelial Cells.
26305474 2015 Vascular Proteomics Reveal Novel Proteins Involved in SMC Phenotypic Change: OLR1 as a SMC Receptor Regulating Proliferation and Inflammatory Response.
26296941 2016 LOX-1 gene variants and maternal levels of plasma oxidized LDL and malondialdehyde in patients with gestational diabetes mellitus.
26185381 2015 Increased serum soluble lectin-like oxidized low-density lipoprotein receptor-1 levels in patients with biopsy-proven nonalcoholic fatty liver disease.
More...