Property Summary

NCBI Gene PubMed Count 230
PubMed Score 733.03
PubTator Score 509.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.13756056829632E-38
psoriasis 6685 6.01368249302356E-38
breast carcinoma 1614 1.72778286154119E-23
non-small cell lung cancer 2798 2.45453451410174E-22
tuberculosis and treatment for 3 months 327 6.59768805518693E-10
lung cancer 4473 2.59050910056631E-8
lung adenocarcinoma 2714 4.07594428629307E-8
invasive ductal carcinoma 2950 4.67763171973042E-6
pilocytic astrocytoma 3086 1.70915880518898E-5
malignant mesothelioma 3163 3.20883910662993E-5
cystic fibrosis 1670 1.86648982191881E-4
pancreatic cancer 2300 0.00146863671007709
glioblastoma 5572 0.00283687218016544
pediatric high grade glioma 2712 0.00338195798456743
ductal carcinoma in situ 1745 0.00487342471222513
medulloblastoma, large-cell 6234 0.0073567297658003
group 3 medulloblastoma 2254 0.0138713415302316
astrocytoma 1493 0.0227011890123906
mucosa-associated lymphoid tissue lymphoma 480 0.0232938382202173
osteosarcoma 7933 0.0275586445572988
colon cancer 1475 0.0469698851667978

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -1.779 0.028
glioblastoma 3.100 0.003
group 3 medulloblastoma -1.800 0.014
astrocytoma 2.000 0.023
medulloblastoma, large-cell -1.600 0.007
tuberculosis and treatment for 3 months -8.300 0.000
non-small cell lung cancer -3.336 0.000
lung cancer -5.900 0.000
colon cancer 1.600 0.047
pancreatic cancer 1.900 0.001
cystic fibrosis 1.400 0.000
lung adenocarcinoma -1.700 0.000
pediatric high grade glioma 1.800 0.003
pilocytic astrocytoma 2.300 0.000
invasive ductal carcinoma 3.698 0.000
lung carcinoma -5.300 0.000
breast carcinoma 1.100 0.000
mucosa-associated lymphoid tissue lympho... 2.979 0.023
ductal carcinoma in situ 1.200 0.005
psoriasis 2.700 0.000

Synonym

Accession P78380 A8K7V9 B4DI48 G3V1I4 Q2PP00 Q7Z484 Ox-LDL receptor 1
Symbols LOX1
LOXIN
SLOX1
CLEC8A
SCARE1

Gene

PDB

1YPO   1YPQ   1YPU   1YXJ   1YXK   3VLG  

  Ortholog (7)

 CSPA Cell Line (2)

Gene RIF (215)

PMID Text
26906623 The mechanistic link between miR-590-5p and LOX-1:miR-590-5p downregulation led to LOX-1 upregulation in endothelial cells.
26892134 Serum LAB was associated with an increased carotid IMT in Japanese men, especially those with hypercholesterolemia
26752047 rapamycin reduces mTOR phosphorylation and subsequently inhibit NF-kappaB activation and suppresses LOX-1, resulting in a reduction in ox-LDL uptake in HUVECs
26666837 the current meta-analysis highlighted that variant allele of OLR1 rs11053646 G > C and PCSK9 rs505151 A > G may contribute to the susceptibility risk of ischemic stroke.
26607724 Interaction between Lox-1, C-reactive protein and oxidized LDL play role in the pathogenesis of atherosclerosis.
26510581 Silencing of LOX-1 gene expression abolished ox-LDL induced effects in cell viability, reactive oxygen species generation and gene expression.
26495844 Cholesterol depletion triggers the release of LOX-1 in exosomes as a full-length transmembrane isoform and as a truncated ectodomain soluble fragment.
26305474 OLR1 is a novel molecular link between the proliferative and inflammatory responses of vascular smooth muscle cells.
26296941 for our Turkish sample group, LOX-1 30UTR188C/T and K167N polymorphisms may not be involved in susceptibility to GDM [gestational diabetes mellitus ]
26185381 The serum LOX-1 levels were significantly higher in NAFLD patients than in healthy controls.
More...

AA Sequence

MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE      1 - 70
QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC     71 - 140
SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN    141 - 210
PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ           211 - 273
//

Text Mined References (233)

PMID Year Title
26906623 2016 MiR-590-5p-meidated LOX-1 upregulation promotes Angiotensin II-induced endothelial cell apoptosis.
26892134 Serum level of LOX-1 ligand containing ApoB is associated with increased carotid intima-media thickness in Japanese community-dwelling men, especially those with hypercholesterolemia LOX-1 ligand and IMT in Japanese.
26752047 2016 Rapamycin Inhibits Oxidized Low Density Lipoprotein Uptake in Human Umbilical Vein Endothelial Cells via mTOR/NF-?B/LOX-1 Pathway.
26666837 2015 The Influence of OLR1 and PCSK9 Gene Polymorphisms on Ischemic Stroke: Evidence from a Meta-Analysis.
26607724 2016 Interplay between CRP, Atherogenic LDL, and LOX-1 and Its Potential Role in the Pathogenesis of Atherosclerosis.
26510581 2015 Modulation of oxidized-LDL receptor-1 (LOX1) contributes to the antiatherosclerosis effect of oleanolic acid.
26495844 2015 Membrane Cholesterol Modulates LOX-1 Shedding in Endothelial Cells.
26305474 2015 Vascular Proteomics Reveal Novel Proteins Involved in SMC Phenotypic Change: OLR1 as a SMC Receptor Regulating Proliferation and Inflammatory Response.
26296941 2016 LOX-1 gene variants and maternal levels of plasma oxidized LDL and malondialdehyde in patients with gestational diabetes mellitus.
26185381 2015 Increased serum soluble lectin-like oxidized low-density lipoprotein receptor-1 levels in patients with biopsy-proven nonalcoholic fatty liver disease.
More...