Property Summary

NCBI Gene PubMed Count 246
PubMed Score 744.16
PubTator Score 509.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.700 3.6e-02
astrocytoma 2.000 2.3e-02
Astrocytoma, Pilocytic 2.300 1.6e-05
breast carcinoma 1.100 1.7e-23
colon cancer 1.600 4.7e-02
cystic fibrosis 1.400 1.9e-04
ductal carcinoma in situ 1.200 4.9e-03
glioblastoma 1.500 3.4e-03
group 3 medulloblastoma -1.800 1.4e-02
invasive ductal carcinoma 3.698 4.7e-06
lung adenocarcinoma -1.600 1.5e-05
lung cancer -5.900 2.6e-08
lung carcinoma -5.300 1.1e-38
malignant mesothelioma 1.300 3.2e-05
medulloblastoma, large-cell -1.600 7.4e-03
mucosa-associated lymphoid tissue lympho... 2.979 2.3e-02
non-small cell lung cancer -3.336 2.5e-22
osteosarcoma -1.779 2.8e-02
pancreatic cancer 1.900 1.5e-03
psoriasis 2.700 6.0e-38
tuberculosis -8.200 2.1e-09

 CSPA Cell Line (2)

Protein-protein Interaction (1)

F5  

Gene RIF (230)

AA Sequence

MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE      1 - 70
QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC     71 - 140
SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN    141 - 210
PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ           211 - 273
//

Text Mined References (249)

PMID Year Title