Property Summary

NCBI Gene PubMed Count 39
Grant Count 7
R01 Count 7
Funding $1,088,323.5
PubMed Score 26.83
PubTator Score 18.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P78371 A8K402 B5BTY7 B7Z243 B7Z7K4 B7ZAT2 Q14D36 Q6IAT3 TCP-1-beta
Symbols CCTB
99D8.1
PRO1633
CCT-beta
HEL-S-100n
TCP-1-beta

Gene

PANTHER Protein Class (2)

Gene RIF (14)

PMID Text
25704758 A role for the TRiC subunits TCP1 and CCT2, and potentially the entire TRiC complex, in breast cancer.
24375412 PDCD5 bound the apical domain of the CCTbeta subunit, projecting above the folding cavity without entering it. Like PDCD5, beta-tubulin also interacts with the CCTbeta apical domain, but a second site is found at the sensor loop deep within the folding cavity.
23782473 Increased expression of CCT2 is associated with tumor progression and the clinical behavior of gallbladder carcinoma.
23190606 Destruction of the beta-tubulin:CCT-beta complex provokes Hsp90-dependent protein ubiquitination and degradation.
23166591 Tandem affinity purification and mass spectrometry analysis identify chaperonin containing TCP1 subunit 2 (CCT2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify chaperonin containing TCP1 subunit 2 (CCT2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify chaperonin containing TCP1 subunit 2 (CCT2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify chaperonin containing TCP1 subunit 2 (CCT2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify chaperonin containing TCP1 subunit 2 (CCT2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20573828 PB2 associates with CCT2 as a monomer and the CCT binding site is located in a central region of the PB2 protein.
More...

AA Sequence

MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATI      1 - 70
LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREA     71 - 140
LLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLA    141 - 210
DSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVE    211 - 280
RILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIE    281 - 350
EVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHA    351 - 420
VTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAI    421 - 490
LGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC                             491 - 535
//

Text Mined References (52)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25704758 2015 Two members of the TRiC chaperonin complex, CCT2 and TCP1 are essential for survival of breast cancer cells and are linked to driving oncogenes.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
24375412 2014 Programmed cell death protein 5 interacts with the cytosolic chaperonin containing tailless complex polypeptide 1 (CCT) to regulate ?-tubulin folding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23782473 2013 Clinicopathological features and CCT2 and PDIA2 expression in gallbladder squamous/adenosquamous carcinoma and gallbladder adenocarcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...