Property Summary

NCBI Gene PubMed Count 39
PubMed Score 28.33
PubTator Score 18.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.512 5.2e-05
atypical teratoid/rhabdoid tumor 1.200 8.8e-04
dermatomyositis 1.600 2.2e-04
Gaucher disease type 1 -1.100 8.8e-03
glioblastoma 1.400 6.0e-03
group 3 medulloblastoma 1.800 1.1e-02
hereditary spastic paraplegia -1.032 1.5e-02
invasive ductal carcinoma 1.200 1.4e-02
lung adenocarcinoma 2.079 7.3e-06
lung cancer 1.700 2.1e-04
medulloblastoma, large-cell 1.400 4.4e-03
Multiple myeloma 1.589 1.1e-03
nasopharyngeal carcinoma 1.200 5.7e-03
non diabetic and post-ischemic heart fai... -1.100 3.2e-02
non-small cell lung cancer 1.241 7.8e-12
ovarian cancer 1.600 1.3e-05
Parkinson's disease -1.100 3.6e-02
psoriasis 1.500 1.7e-05
Waldenstrons macroglobulinemia 1.592 1.2e-02

Gene RIF (12)

AA Sequence

MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATI      1 - 70
LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREA     71 - 140
LLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLA    141 - 210
DSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVE    211 - 280
RILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIE    281 - 350
EVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHA    351 - 420
VTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAI    421 - 490
LGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC                             491 - 535
//

Text Mined References (53)

PMID Year Title