Property Summary

NCBI Gene PubMed Count 27
PubMed Score 20.77
PubTator Score 18.05

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P78369 Q6IBF9 Q96N78
Symbols OSP-L
CPETRL3

Gene

PANTHER Protein Class (2)

Gene RIF (13)

PMID Text
26340953 localization of Cldn3, Cldn7 and Cldn10 proteins in the different compartments of murine endometrium up to day 8.5 of pregnancy (dpc) as well as in human endometrium and first trimester decidua
25867809 An algorithm combining CLDN10, HMGA2, and LAMB3 transcripts was able to discriminate tumors from BTL samples (94% sensitivity and 96% specificity in validation set).
24325792 Claudin 10 expression was down-regulated in gastric cancer.
23760508 In claudin-10b, the F66L mutant reduced cation selectivity, and the F66A mutant lost pore conductance
23591077 Expression of CLDN1 and CLDN10 was lower in invasive lepidic predominant adenocarcinoma than in lung adenocarcioma in situ. Overexpression of CLDN1 and CLDN10 indicates a favorable prognosis in some patients with lung adenocarcinoma.
23284715 The yeast two-hybrid screen identifies the HIV-1 Nef interacting human protein claudin 10 (CLDN10), which co-localizes with Nef mainly in the tight junction region and at the vesicular structures
22076167 Claudin 10/18 are most commonly expressed in lung adenocarcinomas. Female patients and non-smokers express these claudins more commonly suggesting that they may play a part in the carcinogenesis of tobacco unrelated carcinoma.
21647678 Claudin 10 protein is highly expressed in hepatocellular carcinoma (HCC) tissue and is closely related to angiogenesis. It could be a useful marker to predict poor prognosis of HCC patients after hepatectomy.
21370593 CLDN10 is a novel biomarker for detecting ovarian cancer in the chicken, a suitable animal model for investigating the effect and function of CLDN in human ovarian cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSML      1 - 70
ALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYAN     71 - 140
KITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGG    141 - 210
EDFKTTNPSKQFDKNAYV                                                        211 - 228
//

Text Mined References (28)

PMID Year Title
26340953 2015 Claudin-3, claudin-7, and claudin-10 show different distribution patterns during decidualization and trophoblast invasion in mouse and human.
25867809 2015 High Diagnostic Accuracy Based on CLDN10, HMGA2, and LAMB3 Transcripts in Papillary Thyroid Carcinoma.
24325792 2013 The distinct expression patterns of claudin-10, -14, -17 and E-cadherin between adjacent non-neoplastic tissues and gastric cancer tissues.
23760508 2013 Conserved aromatic residue confers cation selectivity in claudin-2 and claudin-10b.
23591077 2013 Expression of CLDN1 and CLDN10 in lung adenocarcinoma in situ and invasive lepidic predominant adenocarcinoma.
22076167 2011 Claudins 10 and 18 are predominantly expressed in lung adenocarcinomas and in tumors of nonsmokers.
21647678 2011 Expression of claudin 10 protein in hepatocellular carcinoma: impact on survival.
21370593 2010 Claudin 10 is a glandular epithelial marker in the chicken model as human epithelial ovarian cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19924644 2010 Claudins in human cancer: a review.
More...