Property Summary

NCBI Gene PubMed Count 29
PubMed Score 25.33
PubTator Score 18.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
acute myeloid leukemia -1.700 1.3e-02
adult high grade glioma -1.800 2.2e-03
astrocytic glioma -3.500 2.8e-03
atypical teratoid / rhabdoid tumor -2.500 2.0e-03
Breast cancer -1.200 5.1e-04
Down syndrome 1.300 1.9e-03
ependymoma -3.200 2.6e-02
glioblastoma -1.900 4.6e-04
group 3 medulloblastoma -4.000 3.8e-07
head and neck cancer and chronic obstruc... -1.300 2.7e-03
intraductal papillary-mucinous adenoma (... -3.300 1.5e-02
intraductal papillary-mucinous carcinoma... -4.300 7.8e-03
lung adenocarcinoma 1.100 3.0e-04
lung cancer 1.700 8.8e-03
medulloblastoma, large-cell -3.600 1.9e-07
mucosa-associated lymphoid tissue lympho... -1.347 1.1e-02
nasopharyngeal carcinoma -2.700 2.3e-10
nephrosclerosis -1.476 1.9e-02
non-small cell lung cancer 1.962 7.4e-08
oligodendroglioma -3.000 6.7e-03
osteosarcoma -1.595 1.3e-02
ovarian cancer 2.700 3.9e-05
pancreatic cancer -1.700 3.4e-03
periodontitis 1.100 2.3e-23
primary pancreatic ductal adenocarcinoma -1.767 7.9e-03
primitive neuroectodermal tumor -3.800 2.1e-04
psoriasis -1.300 4.9e-03
severe Alzheimer's disease -1.061 1.8e-02
subependymal giant cell astrocytoma -2.603 5.7e-03

Protein-protein Interaction (2)

Gene RIF (14)

AA Sequence

MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSML      1 - 70
ALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYAN     71 - 140
KITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGG    141 - 210
EDFKTTNPSKQFDKNAYV                                                        211 - 228
//

Text Mined References (30)

PMID Year Title