Property Summary

Ligand Count 10
NCBI Gene PubMed Count 20
PubMed Score 2.51
PubTator Score 8.01

Knowledge Summary

Patent (1,779)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.300 5.4e-03
glioblastoma -1.200 5.3e-04
group 4 medulloblastoma -1.100 1.9e-02
medulloblastoma, large-cell -1.500 3.1e-05
ovarian cancer -1.200 7.5e-08
pancreatic ductal adenocarcinoma liver m... 1.002 1.9e-02
psoriasis 1.100 4.1e-03
Rheumatoid arthritis 1.600 6.8e-03

 GWAS Trait (1)

Protein-protein Interaction (8)

Gene RIF (7)

AA Sequence

MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNE      1 - 70
YVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLK     71 - 140
TVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHK    141 - 210
SLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLC    211 - 280
ENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQ    281 - 350
LRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK         351 - 415
//

Text Mined References (26)

PMID Year Title