Property Summary

NCBI Gene PubMed Count 20
PubMed Score 2.51
PubTator Score 8.01

Knowledge Summary

Patent (1,779)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 7.47182232116653E-8
medulloblastoma, large-cell 6234 3.12082381956291E-5
glioblastoma 5572 5.33865531883868E-4
psoriasis 6685 0.00412956031883892
adult high grade glioma 2148 0.00542215121870256
Rheumatoid Arthritis 1171 0.0068460998418439
group 4 medulloblastoma 1875 0.019080277407794
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0191722767808357
Disease Target Count Z-score Confidence
Gilles de la Tourette syndrome 47 3.436 1.7
Follicular adenoma 8 3.295 1.6

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.600 0.007
psoriasis 1.100 0.004
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.500 0.000
pancreatic ductal adenocarcinoma liver m... 1.002 0.019
adult high grade glioma -1.300 0.005
group 4 medulloblastoma -1.100 0.019
ovarian cancer -1.200 0.000

Synonym

Accession P78368 B5BU42 O00704 Q8WUB1 CKI-gamma 2
Symbols CK1g2

Gene

PDB

2C47  

  Ortholog (8)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Zebrafish OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (7)

PMID Text
19005213 These results indicate that CKIgamma2 hyperphosphorylates the serine-repeat motif of CERT, thereby inactivating CERT and down-regulating the synthesis of sphingomyelin.
18794808 Ligand-dependent ubiquitination of Smad3 is regulated by CK1g2, an inhibitor of TGF-beta signaling.
15917222 CK1epsilon and CK1gamma2 were found to bind to Per1 and to promote its degradation
15342122 Observational study of gene-disease association. (HuGE Navigator)
15300631 Data indicate that SNPs rs740423, rs2277737, rs1059684 of CSNK1G2 gene may contribute to familial febrile convulsions in children.
15300631 Observational study of gene-disease association. (HuGE Navigator)
15077195 MTA1s interacts with CKI-gamma2, which can phosphorylate MTA1s in an antiestrogen-dependent manner.Estrogen stimulates CKI-gamma2. CKI-gamma2 phosphorylates and modulates the functions of MTA1s.

AA Sequence

MDFDKKGGKGETEEGRRMSKAGGGRSSHGIRSSGTSSGVLMVGPNFRVGKKIGCGNFGELRLGKNLYTNE      1 - 70
YVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFTLK     71 - 140
TVLMIAIQLITRMEYVHTKSLIYRDVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHK    141 - 210
SLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLC    211 - 280
ENFPEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGFVFDYEYDWAGKPLPTPIGTVHTDLPSQPQ    281 - 350
LRDKTQPHSKNQALNSTNGELNADDPTAGHSNAPITAPAEVEVADETKCCCFFKRRKRKSLQRHK         351 - 415
//

Text Mined References (26)

PMID Year Title
25500533 2014 Phosphorylation of LRRK2 by casein kinase 1? regulates trans-Golgi clustering via differential interaction with ARHGEF7.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19005213 2009 Casein kinase I{gamma}2 down-regulates trafficking of ceramide in the synthesis of sphingomyelin.
18794808 2008 Ligand-dependent ubiquitination of Smad3 is regulated by casein kinase 1 gamma 2, an inhibitor of TGF-beta signaling.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...