Property Summary

NCBI Gene PubMed Count 13
Grant Count 36
R01 Count 19
Funding $5,841,202.96
PubMed Score 46.88
PubTator Score 13.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.249 0.044
sonic hedgehog group medulloblastoma 1.300 0.013

Gene RIF (6)

PMID Text
26363466 PI3K-mediated suppression of Nkx3.2 in chondrocytes plays a role in the control of cartilage hypertrophy during skeletal development in vertebrates.
26245691 Our findings indicate that BAPX-1/NKX-3.2 is a molecular switch that is involved in controlling the hypertrophic phenotype of the postdevelopmental (OA) articular chondrocyte.
22507129 Ihh-induced Nkx3.2 degradation requires Wnt5a, which is capable of triggering Nkx3.2 degradation
21606193 Data show that IkappaB kinase beta (IKKbeta) can be activated in the nucleus by Nkx3.2 in the absence of exogenous IKK-activating signals, allowing constitutive nuclear degradation of IkappaB-alpha.
20004766 NKX3-2 plays an important role in endochondral ossification of both the axial and appendicular skeleton in humans
15024065 Data show that Meox1 activates the Bapx1 promoter in a dose-dependent manner and that this activity is enhanced in the presence of Pax1 and/or Pax9.

AA Sequence

MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCCWRLFGERDAGALGGAEDSL      1 - 70
LASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAGGSLSLGQPVCELAASKDLEE     71 - 140
EAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSGAGGGGGSGPAGVAEEEEEPAAPKPRKKRSR    141 - 210
AAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKV    211 - 280
AVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ                     281 - 333
//

Text Mined References (13)

PMID Year Title
26363466 2015 Suppression of Nkx3.2 by phosphatidylinositol-3-kinase signaling regulates cartilage development by modulating chondrocyte hypertrophy.
26245691 2015 BAPX-1/NKX-3.2 acts as a chondrocyte hypertrophy molecular switch in osteoarthritis.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
22507129 2012 Indian Hedgehog signalling triggers Nkx3.2 protein degradation during chondrocyte maturation.
21606193 2011 Exogenous signal-independent nuclear IkappaB kinase activation triggered by Nkx3.2 enables constitutive nuclear degradation of IkappaB-alpha in chondrocytes.
20004766 2009 Homozygous inactivating mutations in the NKX3-2 gene result in spondylo-megaepiphyseal-metaphyseal dysplasia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15024065 2004 Meox homeodomain proteins are required for Bapx1 expression in the sclerotome and activate its transcription by direct binding to its promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.
More...