Property Summary

NCBI Gene PubMed Count 15
PubMed Score 48.53
PubTator Score 13.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.249 4.4e-02
sonic hedgehog group medulloblastoma 1.300 1.3e-02

Gene RIF (8)

AA Sequence

MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVCCWRLFGERDAGALGGAEDSL      1 - 70
LASPAGTRTAAGRTAESPEGWDSDSALSEENESRRRCADARGASGAGLAGGSLSLGQPVCELAASKDLEE     71 - 140
EAAGRSDSEMSASVSGDRSPRTEDDGVGPRGAHVSALCSGAGGGGGSGPAGVAEEEEEPAAPKPRKKRSR    141 - 210
AAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKV    211 - 280
AVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ                     281 - 333
//

Text Mined References (15)

PMID Year Title