Property Summary

NCBI Gene PubMed Count 15
PubMed Score 35.55
PubTator Score 27.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
ovarian cancer 8492 1.48808741438312E-6
osteosarcoma 7933 8.64382234885814E-6
tuberculosis and treatment for 6 months 686 3.41038247462108E-5
group 3 medulloblastoma 2254 4.72757734448393E-4
oligodendroglioma 2849 0.00473475778590184
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.01053098131785
Disease Target Count Z-score Confidence
Microcephaly 149 3.14 1.6
Disease Target Count Z-score Confidence
Embryonal carcinoma 11 4.105 2.1

Expression

  Differential Expression (6)

Synonym

Accession P78364 D3DUV4 Q8WVM3 Q9BU63 hPH1
Symbols EDR1
HPH1
RAE28
MCPH11

Gene

PDB

2L8E  

  Ortholog (9)

Species Source
Chimp OMA Inparanoid
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

 GWAS Trait (1)

Gene RIF (2)

PMID Text
23418308 These findings reveal several cellular defects in cells carrying the PHC1 mutation and highlight the role of chromatin remodeling in the pathogenesis of PM.
18650381 PcG complex 1, involving Rae28 and Cdt1, supports the activity of hematopoietic stem cells by enhancing cycling capability and hematopoietic activity through direct regulation of Geminin

AA Sequence

METESEQNSNSTNGSSSSGGSSRPQIAQMSLYERQAVQALQALQRQPNAAQYFHQFMLQQQLSNAQLHSL      1 - 70
AAVQQATIAASRQASSPNTSTTQQQTTTTQASINLATTSAAQLISRSQSVSSPSATTLTQSVLLGNTTSP     71 - 140
PLNQSQAQMYLRPQLGNLLQVNRTLGRNVPLASQLILMPNGAVAAVQQEVPSAQSPGVHADADQVQNLAV    141 - 210
RNQQASAQGPQMQGSTQKAIPPGASPVSSLSQASSQALAVAQASSGATNQSLNLSQAGGGSGNSIPGSMG    211 - 280
PGGGGQAHGGLGQLPSSGMGGGSCPRKGTGVVQPLPAAQTVTVSQGSQTEAESAAAKKAEADGSGQQNVG    281 - 350
MNLTRTATPAPSQTLISSATYTQIQPHSLIQQQQQIHLQQKQVVIQQQIAIHHQQQFQHRQSQLLHTATH    351 - 420
LQLAQQQQQQQQQQQQQQQPQATTLTAPQPPQVPPTQQVPPSQSQQQAQTLVVQPMLQSSPLSLPPDAAP    421 - 490
KPPIPIQSKPPVAPIKPPQLGAAKMSAAQQPPPHIPVQVVGTRQPGTAQAQALGLAQLAAAVPTSRGMPG    491 - 560
TVQSGQAHLASSPPSSQAPGALQECPPTLAPGMTLAPVQGTAHVVKGGATTSSPVVAQVPAAFYMQSVHL    561 - 630
PGKPQTLAVKRKADSEEERDDVSTLGSMLPAKASPVAESPKVMDEKSSLGEKAESVANVNANTPSSELVA    631 - 700
LTPAPSVPPPTLAMVSRQMGDSKPPQAIVKPQILTHIIEGFVIQEGAEPFPVGCSQLLKESEKPLQTGLP    701 - 770
TGLTENQSGGPLGVDSPSAELDKKANLLKCEYCGKYAPAEQFRGSKRFCSMTCAKRYNVSCSHQFRLKRK    771 - 840
KMKEFQEANYARVRRRGPRRSSSDIARAKIQGKCHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGE    841 - 910
RDLGNPNTAPPTPELHGINPVFLSSNPSRWSVEEVYEFIASLQGCQEIAEEFRSQEIDGQALLLLKEEHL    911 - 980
MSAMNIKLGPALKICAKINVLKET                                                  981 - 1004
//

Text Mined References (18)

PMID Year Title
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23418308 2013 Mutation in PHC1 implicates chromatin remodeling in primary microcephaly pathogenesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21282530 2011 Interaction proteomics analysis of polycomb proteins defines distinct PRC1 complexes in mammalian cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19636380 2009 Several distinct polycomb complexes regulate and co-localize on the INK4a tumor suppressor locus.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18650381 2008 Polycomb-group complex 1 acts as an E3 ubiquitin ligase for Geminin to sustain hematopoietic stem cell activity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
More...