Property Summary

Ligand Count 1
NCBI Gene PubMed Count 40
PubMed Score 17.51
PubTator Score 15.78

Knowledge Summary

Patent (3,352)

Expression

  Differential Expression (17)

Disease log2 FC p
acute quadriplegic myopathy 1.459 1.2e-07
adrenocortical carcinoma 1.116 3.9e-03
adult high grade glioma -1.500 3.5e-05
aldosterone-producing adenoma -1.197 2.6e-02
Astrocytoma, Pilocytic -1.400 2.3e-05
atypical teratoid / rhabdoid tumor -1.200 3.1e-04
cystic fibrosis -1.129 1.3e-03
ependymoma -1.200 3.9e-08
glioblastoma -1.200 1.6e-07
group 4 medulloblastoma -1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 1.200 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 1.2e-02
medulloblastoma, large-cell -1.100 3.5e-03
Multiple myeloma 1.229 3.1e-03
osteosarcoma 1.230 7.0e-03
ovarian cancer 1.100 6.1e-03
subependymal giant cell astrocytoma -1.138 2.7e-02

Pathway (1)

Gene RIF (16)

AA Sequence

MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGYHP      1 - 70
VKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDP     71 - 140
NKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKI    141 - 210
IHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQA    211 - 280
ELLEKRLQEIEELEREAERKIIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEE    281 - 350
KEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPN    351 - 420
AESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRS    421 - 490
RTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAG    491 - 560
YSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGEL    561 - 630
RHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS                631 - 688
//

Text Mined References (53)

PMID Year Title