Property Summary

NCBI Gene PubMed Count 35
Grant Count 9
R01 Count 9
Funding $657,660.75
PubMed Score 14.79
PubTator Score 15.78

Knowledge Summary

Patent (3,352)

Expression

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (11)

PMID Text
26244849 Data indicate serine/arginine-rich protein kinases SRPK1/2/SRPIN340 complexes by molecular docking and molecular dynamics.
24444330 A conserved electronegative docking groove in SRPK2 is responsible for substrate binding.
23326445 the BLRF2 RS motif is phosphorylated by SRPK2 and is important for viral replication.
20498328 Our results demonstrate that SRPK1 and SRPK2 are host factors essential for Hepatitis C virus replication.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19902070 Short-term exercise resulted in a significant increase of mRNA expression of genes encoding proteins involved in the formation of precatalytic splisosome: SRPK2.
19592491 Interaction of Akt-phosphorylated SRPK2 with 14-3-3 mediates cell cycle and cell death in neurons.
18559500 overexpression of SRPK2 is associated with phosphorylating acinus and regulating its stimulatory effects on cyclin A1 expression, contributing to leukemia cell proliferation
18425142 SRPK2 knock down results in hypophosphorylation of the arginine-serine (RS) domain-containing human PRP28 protein (PRP28, also known as DDX23), and destabilizes PRP28 association with the tri-snRNP.
16122776 negative role of SRPK1 and SRPK2 in the regulation of HBV replication through a mechanism not involving the phosphorylation of the core protein
More...

AA Sequence

MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDPADYCKGGYHP      1 - 70
VKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDP     71 - 140
NKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKI    141 - 210
IHTDIKPENILMCVDDAYVRRMAAEATEWQKAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQA    211 - 280
ELLEKRLQEIEELEREAERKIIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEE    281 - 350
KEDAEKENIEKDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPN    351 - 420
AESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRS    421 - 490
RTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAG    491 - 560
YSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRRGEL    561 - 630
RHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWLNS                631 - 688
//

Text Mined References (48)

PMID Year Title
26244849 2015 Potential Antileukemia Effect and Structural Analyses of SRPK Inhibition by N-(2-(Piperidin-1-yl)-5-(Trifluoromethyl)Phenyl)Isonicotinamide (SRPIN340).
25416956 2014 A proteome-scale map of the human interactome network.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24444330 2014 Primary structural features of SR-like protein acinusS govern the phosphorylation mechanism by SRPK2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23326445 2013 An RS motif within the Epstein-Barr virus BLRF2 tegument protein is phosphorylated by SRPK2 and is important for viral replication.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
More...