Property Summary

NCBI Gene PubMed Count 19
Grant Count 142
R01 Count 48
Funding $26,893,957.37
PubMed Score 463.68
PubTator Score 238.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 5.343 2.7

Synonym

Accession P78358 A1L417 B7WNL9 Q7LBY4 Q9NY13
Symbols ESO1
CT6.1
LAGE-2
LAGE2A
NY-ESO-1

Gene

PDB

1S9W   2BNQ   2BNR   2F53   2F54   2P5E   2P5W   2PYE   3GJF   3HAE   3KLA  

Gene RIF (1)

PMID Text
16596224 Expression may represent potential targets for cancer immunotherapy in patients with non small cell lung carcinoma.

AA Sequence

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS      1 - 70
GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA     71 - 140
DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR                                  141 - 180
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20518717 2010 Evaluation of cellular immune responses in cancer vaccine recipients: lessons from NY-ESO-1.
20208059 2010 Screening for biomarkers of spermatogonia within the human testis: a whole genome approach.
17137291 2006 Physical interaction of two cancer-testis antigens, MAGE-C1 (CT7) and NY-ESO-1 (CT6).
16596224 2006 Expression of the MAGE-A4 and NY-ESO-1 cancer-testis antigens and T cell infiltration in non-small cell lung carcinoma and their prognostic significance.
15837811 2005 Structural and kinetic basis for heightened immunogenicity of T cell vaccines.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445278 2002 Cancer/testis antigens: an expanding family of targets for cancer immunotherapy.
More...