Property Summary

NCBI Gene PubMed Count 19
PubMed Score 490.73
PubTator Score 238.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 5.391 2.7

Gene RIF (1)

AA Sequence

MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAAS      1 - 70
GLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAA     71 - 140
DHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR                                  141 - 180
//

Text Mined References (20)

PMID Year Title