Property Summary

NCBI Gene PubMed Count 21
Grant Count 1
R01 Count 1
Funding $180,312
PubMed Score 7.01
PubTator Score 15.69

Knowledge Summary

Patent (2,536)

Synonym

Accession P78356 Q5U0E8 Q8TBP2
Symbols PI5P4KB
PIP5K2B
PIP5KIIB
PIP5P4KB
PIP5KIIbeta

Gene

PANTHER Protein Class (2)

 Grant Application (1)

PDB

1BO1   3WZZ   3X01   3X02   3X03   3X04   3X05   3X06   3X07   3X08   3X09   3X0A   3X0B   3X0C  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (5)

PMID Text
25728392 Suppression of PIP4K expression selectively prevents tumor cell growth in vitro and prevents tumor development in mice that have lost the tumor suppressor p53. (Review)
24209622 Knocking down PI5P4Kalpha and beta in a breast cancer cell line bearing an amplification of the gene encoding PI5P4K beta and deficient for p53 impaired growth on plastic and in xenografts.
24127122 Association between low PIP4K2B expression and poor patient survival.Analysis of gene expression datasets confirmed the association between low PIP4K2B and low CDH1expression.
21514270 These results indicate that PIPKIIbeta-mediated PI(4,5)P(2) signaling is important for E-cadherin upregulation and inhibition of cellular motility induced by VDR activation.
17303380 PIPkin IIbeta is expressed as a tagged protein, is active as revealed by immunoprecipitation and enzyme assay, and that cellular fractionation reveals that it is indeed nuclear.

AA Sequence

MSSNCTSTTAVAVAPLSASKTKTKKKHFVCQKVKLFRASEPILSVLMWGVNHTINELSNVPVPVMLMPDD      1 - 70
FKAYSKIKVDNHLFNKENLPSRFKFKEYCPMVFRNLRERFGIDDQDYQNSVTRSAPINSDSQGRCGTRFL     71 - 140
TTYDRRFVIKTVSSEDVAEMHNILKKYHQFIVECHGNTLLPQFLGMYRLTVDGVETYMVVTRNVFSHRLT    141 - 210
VHRKYDLKGSTVAREASDKEKAKDLPTFKDNDFLNEGQKLHVGEESKKNFLEKLKRDVEFLAQLKIMDYS    211 - 280
LLVGIHDVDRAEQEEMEVEERAEDEECENDGVGGNLLCSYGTPPDSPGNLLSFPRFFGPGEFDPSVDVYA    281 - 350
MKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFNEFMSNILT        351 - 416
//

Text Mined References (28)

PMID Year Title
25728392 2015 PIP4K and the role of nuclear phosphoinositides in tumour suppression.
25578879 2015 PI(5)P regulates autophagosome biogenesis.
25495341 2015 The function of phosphatidylinositol 5-phosphate 4-kinase ? (PI5P4K?) explored using a specific inhibitor that targets the PI5P-binding site.
25416956 2014 A proteome-scale map of the human interactome network.
24209622 2013 Depletion of a putatively druggable class of phosphatidylinositol kinases inhibits growth of p53-null tumors.
24127122 2013 Low PIP4K2B expression in human breast tumors correlates with reduced patient survival: A role for PIP4K2B in the regulation of E-cadherin expression.
23758345 2013 Evolutionarily conserved structural changes in phosphatidylinositol 5-phosphate 4-kinase (PI5P4K) isoforms are responsible for differences in enzyme activity and localization.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21514270 2011 Phosphatidylinositol 5-phosphate 4-kinase type II beta is required for vitamin D receptor-dependent E-cadherin expression in SW480 cells.
21269460 2011 Initial characterization of the human central proteome.
More...