Property Summary

Ligand Count 2
NCBI Gene PubMed Count 165
PubMed Score 883.91
PubTator Score 534.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.500 1.1e-06
Amyotrophic lateral sclerosis -1.188 1.1e-05
astrocytic glioma -2.000 2.3e-03
Astrocytoma, Pilocytic -1.800 2.7e-07
atypical teratoid / rhabdoid tumor -2.800 1.6e-10
autosomal dominant Emery-Dreifuss muscul... -1.254 6.8e-03
ependymoma -2.300 2.2e-03
glioblastoma -2.000 3.7e-09
group 3 medulloblastoma -1.400 5.3e-03
juvenile dermatomyositis -1.016 4.0e-08
lung carcinoma 1.200 9.9e-21
medulloblastoma, large-cell -3.200 2.8e-07
oligodendroglioma -1.700 1.3e-02
osteosarcoma -1.234 3.7e-03
ovarian cancer -1.400 2.9e-08
pancreatic cancer 1.200 1.5e-02
pancreatic carcinoma 1.200 1.5e-02
Pick disease -1.600 5.6e-04
primitive neuroectodermal tumor -1.600 2.8e-04
psoriasis -2.400 5.0e-05
subependymal giant cell astrocytoma -1.980 4.5e-02

Protein-protein Interaction (7)

Gene RIF (59)

AA Sequence

MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLER      1 - 70
GNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEA     71 - 140
GSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGD    141 - 210
KILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGT    211 - 280
DYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLS    281 - 350
GELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGT    351 - 420
ASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPS    421 - 490
KRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFG    491 - 560
SCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDV    561 - 630
SANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEI    631 - 700
YHKVKRVIEDLSGPYIWVPARERL                                                  701 - 724
//

Text Mined References (170)

PMID Year Title