Property Summary

NCBI Gene PubMed Count 156
Grant Count 627
R01 Count 338
Funding $66,282,219.97
PubMed Score 821.24
PubTator Score 534.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
pancreatic cancer 1.200 0.015
astrocytic glioma -2.000 0.002
ependymoma -2.400 0.000
oligodendroglioma -1.700 0.013
psoriasis -2.400 0.000
glioblastoma -2.800 0.000
osteosarcoma -1.234 0.004
medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -1.600 0.000
autosomal dominant Emery-Dreifuss muscul... -1.254 0.007
juvenile dermatomyositis -1.016 0.000
Amyotrophic Lateral Sclerosis -1.188 0.000
adult high grade glioma -2.500 0.000
pilocytic astrocytoma -1.800 0.000
pancreatic carcinoma 1.200 0.015
subependymal giant cell astrocytoma -1.980 0.045
lung carcinoma 1.200 0.000
Pick disease -1.600 0.001
ovarian cancer -1.400 0.000

Synonym

Accession P78352 B7Z1S1 G5E939 Q92941 Q9UKK8
Symbols PSD95
SAP90
SAP-90

Gene

PDB

1KEF   2MES   3I4W   3K82   3ZRT  

 GWAS Trait (1)

Gene RIF (54)

PMID Text
25849917 In this review, we focus on palmitoylation of PSD-95, which is a major postsynaptic scaffolding protein and makes discrete postsynaptic nanodomains in a palmitoylation-dependent manner and discuss a determinant role of local palmitoylation cycles
25678324 Data demonstrate a role for SNAP-25 in controlling PSD-95 clustering and open the possibility that genetic reductions of the protein levels may contribute to the pathology through an effect on postsynaptic function and plasticity.
25658767 Data indicate the very high affinities of the trimeric ligands to postsynaptic density protein 95 (PSD-95) PDZ domains.
25585032 The postsynaptic membrane protein PSD95 was increased in schizophrenia in CA3 tissue, but not in CA1 tissue.
25410733 Docosahexaenoic acid-containing phosphatidylcholines and PSD-95 decrease after loss of synaptophysin and before neuronal loss in patients with Alzheimer's disease.
25406362 PSD-95 mRNA G-rich region folds into alternate G quadruplex conformations that coexist in equilibrium and miR-125a forms a stable complex with PSD-95 mRNA.
25104558 An association was found between reduced PSD95 in the prefrontal cortex and cognitive impairment in patients with either dementia with Lewy bodies or Parkinson's disease dementia.
24513855 The crystal structures of the Dlg4 GK domain in complex with two phosphor-Lgl2 peptides reveal the molecular mechanism underlying the specific and phosphorylation-dependent Dlg/Lgl complex formation.
24491052 HIV-1 gp120 induced-neurotoxicity involves upregulation of NR2B and downregulation of PSD-95 expressions in neuron cells
23936182 A putative role for DLG4 in schizophrenia pathogenesis, evidenced by haplotype association, has been described.
More...

AA Sequence

MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLER      1 - 70
GNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEA     71 - 140
GSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGD    141 - 210
KILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGT    211 - 280
DYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLS    281 - 350
GELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGT    351 - 420
ASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPS    421 - 490
KRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFG    491 - 560
SCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDV    561 - 630
SANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEI    631 - 700
YHKVKRVIEDLSGPYIWVPARERL                                                  701 - 724
//

Text Mined References (160)

PMID Year Title
25849917 2015 Postsynaptic nanodomains generated by local palmitoylation cycles.
25780553 2015 The association of GPR85 with PSD-95-neuroligin complex and autism spectrum disorder: a molecular analysis.
25678324 2015 Reduced SNAP-25 increases PSD-95 mobility and impairs spine morphogenesis.
25658767 2015 Targeting protein-protein interactions with trimeric ligands: high affinity inhibitors of the MAGUK protein family.
25585032 2015 Synaptic proteins in the hippocampus indicative of increased neuronal activity in CA3 in schizophrenia.
25410733 2014 DHA-PC and PSD-95 decrease after loss of synaptophysin and before neuronal loss in patients with Alzheimer's disease.
25406362 2015 G quadruplex RNA structures in PSD-95 mRNA: potential regulators of miR-125a seed binding site accessibility.
25104558 2014 Assessment of ZnT3 and PSD95 protein levels in Lewy body dementias and Alzheimer's disease: association with cognitive impairment.
24513855 2014 Phosphorylation-dependent interaction between tumor suppressors Dlg and Lgl.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
More...