Property Summary

NCBI Gene PubMed Count 67
Grant Count 60
R01 Count 41
Funding $9,201,957.92
PubMed Score 106.53
PubTator Score 255.17

Knowledge Summary

Patent (5,776)

Expression

  Differential Expression (3)

Disease log2 FC p
oligodendroglioma 1.100 0.049
group 4 medulloblastoma 1.600 0.000
pilocytic astrocytoma 1.100 0.000

Synonym

Accession P78348 A3KN86 E5KBL7 P78349 Q96CV2 ASIC1
Symbols ASIC
ACCN2
BNaC2

Gene

PANTHER Protein Class (2)

Gene RIF (49)

PMID Text
26252376 analysis of a major ASIC1a homotetramer at the surface membrane of the cell expressing functional ASIC1a channel
26108662 A novel interaction between ASIC1 and integrin-Beta1, mediated by alpha-actinin was determined in glioma tumor cells.
26070563 ASIC1a opening is accompanied by a distance increase between adjacent thumb and palm domains as well as a movement of Glu-235 relative to the knuckle helix.
26033064 This study suggests that ASIC1 may play a role as mediators of inflammatory pain and be involved in the pathogenesis of frozen shoulder.
26032502 ASIC1A and ENaCalpha form functional heterotrimers acting as ion channels.
25913301 Our findings support previously reported associations between ASIC1 and panic/anxiety, but not other genes previously associated with anxiety disorders. The
25613068 Suppression of ASIC1alpha expression by RNAi attenuated the malignant phenotype of hepatocellular carcinoma cells, suggesting a novel approach for anticancer gene therapy.
24923912 Putative GABAA and ASIC1a channels functionally interact with each other, possibly via an inter-molecular association by forming a novel protein complex.
24847067 Combinatorial analysis suggests a model of random mixing of ASIC1a and ASIC2a subunits to yield both 2:1 and 1:2 ASIC1a:ASIC2a heteromers together with ASIC1a and ASIC2a homomers.
24682892 Down-regulated expression of ASIC1 RNA and protein was detected in the dysplastic cortex of focal cortical dysplasia patients.
More...

AA Sequence

MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCVCTERVQYYFH      1 - 70
YHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQD     71 - 140
KANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTM    141 - 210
KGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRL    211 - 280
IYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPAL    281 - 350
DFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI    351 - 420
EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDD    421 - 490
VKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC                                    491 - 528
//

Text Mined References (68)

PMID Year Title
26252376 2015 The Human Acid-Sensing Ion Channel ASIC1a: Evidence for a Homotetrameric Assembly State at the Cell Surface.
26108662 2015 Physical and functional interactions between a glioma cation channel and integrin-?1 require ?-actinin.
26070563 2015 Extracellular Subunit Interactions Control Transitions between Functional States of Acid-sensing Ion Channel 1a.
26033064 2015 Up-regulation of acid-sensing ion channels in the capsule of the joint in frozen shoulder.
26032502 2015 Atomic force microscopy imaging reveals the formation of ASIC/ENaC cross-clade ion channels.
25913301 2015 Validation of candidate anxiety disorder genes using a carbon dioxide challenge task.
25613068 2015 Involvement of acid-sensing ion channel 1? in hepatic carcinoma cell migration and invasion.
24923912 2014 Identification of a novel protein complex containing ASIC1a and GABAA receptors and their interregulation.
24847067 2014 Acid-sensing ion channel (ASIC) 1a/2a heteromers have a flexible 2:1/1:2 stoichiometry.
24682892 2014 Down-regulated expression of acid-sensing ion channel 1a in cortical lesions of patients with focal cortical dysplasia.
More...