Property Summary

Ligand Count 3
NCBI Gene PubMed Count 73
PubMed Score 126.22
PubTator Score 255.17

Knowledge Summary

Patent (5,776)

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.1e-05
group 4 medulloblastoma 1.400 5.3e-04
oligodendroglioma 1.100 4.9e-02

Gene RIF (55)

AA Sequence

MELKAEEEEVGGVQPVSIQAFASSSTLHGLAHIFSYERLSLKRALWALCFLGSLAVLLCVCTERVQYYFH      1 - 70
YHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEILQD     71 - 140
KANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFTRYGKCYTFNSGRDGRPRLKTM    141 - 210
KGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRL    211 - 280
IYLPPPWGTCKAVTMDSDLDFFDSYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPAL    281 - 350
DFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETI    351 - 420
EQKKAYEIAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDD    421 - 490
VKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC                                    491 - 528
//

Text Mined References (76)

PMID Year Title