Property Summary

NCBI Gene PubMed Count 88
Grant Count 223
R01 Count 67
Funding $28,660,247.48
PubMed Score 108.96
PubTator Score 87.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 2.000 0.016
ependymoma 2.700 0.001
oligodendroglioma 2.800 0.001
psoriasis 1.100 0.000
osteosarcoma 2.014 0.000
group 4 medulloblastoma 2.700 0.000
atypical teratoid / rhabdoid tumor 2.100 0.000
glioblastoma 1.700 0.006
medulloblastoma, large-cell 2.700 0.000
primitive neuroectodermal tumor 1.100 0.000
pediatric high grade glioma 1.200 0.011
aldosterone-producing adenoma -1.466 0.042
Gaucher disease type 1 -1.500 0.012

Synonym

Accession P78347 O14743 O15359 O43546 O43588 O43589 Q75M85 Q75M86 Q75M87 Q75M88 Q86U51 Q9BSZ4 GTFII-I
Symbols WBS
DIWS
SPIN
IB291
BAP135
BTKAP1
TFII-I
WBSCR6
GTFII-I

Gene

PANTHER Protein Class (1)

PDB

2D9B   2DN4   2ED2   2EJE  

Gene RIF (42)

PMID Text
26814176 The authors found that human adenovirus 5 infection or ectopic E4-ORF3 expression leads to SUMOylation of TFII-I that precedes a rapid decline in TFII-I protein levels.
26656605 A novel interaction between TFII-I and Mdm2 with a negative effect on TFII-I transcriptional activity has been documented.
26320362 Study demonstrates a significant association between SLE in Chinese Han population and the GTF2I rs117026326 T allele/GTF2IRD1 rs4717901 C allele.
26285132 Copy-number variation in the general transcription factor gene, GTF2I is associated with gene-dose-dependent anxiety in mouse models and in both Williams syndrome and Dup7.
25926634 Rather than contributing positively to promoter activity, a putative initiator element at the transcription start site acts as a target for negative regulation imposed on the L4P promoter of human adenovirus Type 5 by cellular TFII-I.
25869096 show that SUMOylation is critical for TFII-I to promote cell proliferation and colony formation. Our findings contribute to understanding the role of SUMOylation in liver cancer development
25501393 A proportion of this transcriptional dysregulation is caused by dosage imbalances in GTF2I, which encodes a key transcription factor at 7q11.23 that is associated with the LSD1 repressive chromatin complex and silences its dosage-sensitive targets.
25480810 The GTF2I rs117026326 polymorphism is associated with anti-SSA-positive primary Sjogren's syndrome.
25429715 Findings implicate the GTF2I gene in the neurogenetic basis of social communication and social anxiety, both in Williams syndrome and among individuals in healthy populations
24974848 GTF2I mutation correlated with better survival.
More...

AA Sequence

MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRK      1 - 70
DFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEK     71 - 140
MLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILS    141 - 210
PGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQAGPSETDDVDEKQPLSKPLQGSHHSS    211 - 280
EGNEGTEMEVPAEDSTQHVPSETSEDPEVEVTIEDDDYSPPSKRPKANELPQPPVPEPANAGKRKVREFN    281 - 350
FEKWNARITDLRKQVEELFERKYAQAIKAKGPVTIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLE    351 - 420
RILLAKERIRFVIKKHELLNSTREDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAEALGSTEAKAV    421 - 490
PYQKFEAHPNDLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKRPELLTHSTTEVTQPRTNTPV    491 - 560
KEDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVFESNPEFLYVEGLPEGIPFRSPTWFGIPRLE    561 - 630
RIVRGSNKIKFVVKKPELVISYLPPGMASKINTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNNPQTSA    631 - 700
VRTPTQTNGSNVPFKPRGREFSFEAWNAKITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFY    701 - 770
VEGLPEGVPFRRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESTSSKSPPRKINSSPNVNTTASG    771 - 840
VEDLNIIQVTIPDDDNERLSKVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITINPGCVVVDGMP    841 - 910
PGVSFKAPSYLEISSMRRILDSAEFIKFTVIRPFPGLVINNQLVDQSESEGPVIQESAEPSQLEVPATEE    911 - 980
IKETDGSSQIKQEPDPTW                                                        981 - 998
//

Text Mined References (105)

PMID Year Title
26814176 2016 The Adenovirus E4-ORF3 Protein Stimulates SUMOylation of General Transcription Factor TFII-I to Direct Proteasomal Degradation.
26656605 2015 A Novel Interaction between TFII-I and Mdm2 with a Negative Effect on TFII-I Transcriptional Activity.
26320362 Association of GTF2I and GTF2IRD1 polymorphisms with systemic lupus erythematosus in a Chinese Han population.
26285132 2015 Variation in the Williams syndrome GTF2I gene and anxiety proneness interactively affect prefrontal cortical response to aversive stimuli.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25926634 2015 The Human Adenovirus Type 5 L4 Promoter Is Negatively Regulated by TFII-I and L4-33K.
25869096 2015 Functional Proteomics Study Reveals SUMOylation of TFII-I is Involved in Liver Cancer Cell Proliferation.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25646466 2015 Genome-wide targeting of the epigenetic regulatory protein CTCF to gene promoters by the transcription factor TFII-I.
More...