Property Summary

NCBI Gene PubMed Count 21
PubMed Score 14.12
PubTator Score 12.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.600 1.8e-03
atypical teratoid / rhabdoid tumor -1.900 6.1e-05
ependymoma -1.100 6.5e-04
glioblastoma -1.400 3.1e-05
medulloblastoma -1.600 2.4e-04
medulloblastoma, large-cell -1.800 8.3e-05
osteosarcoma -1.698 2.4e-03
ovarian cancer 1.200 1.9e-05
Pilocytic astrocytoma -1.100 3.5e-03
pituitary cancer 1.300 2.7e-05
primitive neuroectodermal tumor -1.100 2.0e-03
tuberculosis -1.100 1.4e-03

Protein-protein Interaction (9)

Gene RIF (2)

AA Sequence

MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRP      1 - 70
IKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRP     71 - 140
PINVAIDRGLAFELVYSPAIKDSTMRRYTISSALNLMQICKGKNVIISSAAERPLEIRGPYDVANLGLLF    141 - 210
GLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG                211 - 268
//

Text Mined References (29)

PMID Year Title