Property Summary

NCBI Gene PubMed Count 20
PubMed Score 13.67
PubTator Score 12.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -1.698 0.002
ependymoma -1.100 0.001
glioblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.100 0.002
tuberculosis and treatment for 6 months -1.400 0.000
adult high grade glioma -1.600 0.002
pilocytic astrocytoma -1.100 0.003
ovarian cancer 1.200 0.000
pituitary cancer 1.300 0.000

Synonym

Accession P78346 B2R799 E9PB02 RNaseP protein p30
Symbols TSG15

Gene

Gene RIF (2)

PMID Text
25704799 archaeal homologs of the human RNase P proteins Pop5 and Rpp30
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVFADLDLRAGSDLKALRGLVETAAHLGYSVVAINHIVDFKEKKQEIEKPVAVSELFTTLPIVQGKSRP      1 - 70
IKILTRLTIIVSDPSHCNVLRATSSRARLYDVVAVFPKTEKLFHIACTHLDVDLVCITVTEKLPFYFKRP     71 - 140
PINVAIDRGLAFELVYSPAIKDSTMRRYTISSALNLMQICKGKNVIISSAAERPLEIRGPYDVANLGLLF    141 - 210
GLSESDAKAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDEDCLPASKKAKCEG                211 - 268
//

Text Mined References (27)

PMID Year Title
25704799 2015 On archaeal homologs of the human RNase P proteins Pop5 and Rpp30 in the hyperthermophilic archaeon Thermococcus kodakarensis.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22566634 2012 The genetic architecture of economic and political preferences.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...