Property Summary

NCBI Gene PubMed Count 52
Grant Count 3
Funding $821,724.42
PubMed Score 321.96
PubTator Score 28.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma 1.166 0.000
primary pancreatic ductal adenocarcinoma 1.030 0.004
diabetes mellitus 1.200 0.002
acute myeloid leukemia 1.600 0.008
ovarian cancer -1.400 0.000
pancreatic cancer 1.100 0.011

Synonym

Gene

PDB

3D3M   3L6A   4IUL  

Gene RIF (23)

PMID Text
26165837 Knockdown of EIF4G2 recapitulated the effects of mir-139, whereas restoring EIF4G2 expression rescued the mir-139 phenotype. elevated miR-139-5p expression is associated with a favorable outcome in acute myeloid leukemia.
25779044 findings provide the first mechanistic insights into the function of DAP5 as a selective regulator of cap-independent translation
24497838 Our results provide evidence that the tumor suppressor effect of miR-520c-3p is mediated through repression of translation while inducing senescence and that eIF4GII is a key effector of this anti-tumor activity.
23318444 DAP5, a translation initiation factor shown to positively regulate the translation of various internal ribosome entry sites containing mRNAs, promotes internal ribosome entry site-driven translation of p53 mRNA.
22909319 Multiple isoforms of eIF4GII arise from multiple promoters & alternative splicing events. A non-canonical CUG initiation codon extends the eIF4GII N-terminus. The eIF4GII N-terminus plays an alternative role in initiation factor assembly.
22555068 DAP5/p97 and DAP5/p86 enhanced the translation of the anti-apoptotic protein Bcl-2 and inhibited cisplatin-induced apoptosis
20544972 crystal structure of C-terminal region (residues 540-897) of p97/EIF4G2 (at 2.0 Angstrom resolution): sequence/structure homology with EIF4G1
20057060 crystallization and preliminary X-ray diffraction analysis of the MIF4G domain of DAP5 is presented.
19769989 eIF4GI does not colocalize with ribosomes in VSV-infected cells, while eIF2alpha locates at perinuclear sites coincident with ribosomes.
18722383 Results report the crystal structure of the C-terminal region of DAP5/p97 extending between amino acids 730 and 897.
More...

AA Sequence

MESAIAEGGASRFSASSGGGGSRGAPQHYPKTAGNSEFLGKTPGQNAQKWIPARSTRRDDNSAANNSANE      1 - 70
KERHDAIFRKVRGILNKLTPEKFDKLCLELLNVGVESKLILKGVILLIVDKALEEPKYSSLYAQLCLRLA     71 - 140
EDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGN    141 - 210
IKFIGELGKLDLIHESILHKCIKTLLEKKKRVQLKDMGEDLECLCQIMRTVGPRLDHERAKSLMDQYFAR    211 - 280
MCSLMLSKELPARIRFLLQDTVELREHHWVPRKAFLDNGPKTINQIRQDAVKDLGVFIPAPMAQGMRSDF    281 - 350
FLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQS    351 - 420
QFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSFLMNKNQVPKL    421 - 490
QPQITMIPPSAQPPRTQTPPLGQTPQLGLKTNPPLIQEKPAKTSKKPPPSKEELLKLTETVVTEYLNSGN    491 - 560
ANEAVNGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSLISLLKQEGIATSDNFMQAFLNVLDQCP    561 - 630
KLEVDIPLVKSYLAQFAARAIISELVSISELAQPLESGTHFPLFLLCLQQLAKLQDREWLTELFQQSKVN    631 - 700
MQKMLPEIDQNKDRMLEILEGKGLSFLFPLLKLEKELLKQIKLDPSPQTIYKWIKDNISPKLHVDKGFVN    701 - 770
ILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYN    771 - 840
SNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQWLTWLETAEEEESEEEAD       841 - 907
//

Text Mined References (69)

PMID Year Title
26165837 2016 miR-139-5p controls translation in myeloid leukemia through EIF4G2.
25779044 2015 DAP5 associates with eIF2? and eIF4AI to promote Internal Ribosome Entry Site driven translation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
24497838 2014 Down-regulation of eIF4GII by miR-520c-3p represses diffuse large B cell lymphoma development.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23318444 2014 The translation initiation factor DAP5 promotes IRES-driven translation of p53 mRNA.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22909319 2012 Multiple isoforms of the translation initiation factor eIF4GII are generated via use of alternative promoters, splice sites and a non-canonical initiation codon.
More...