Property Summary

Ligand Count 10
NCBI Gene PubMed Count 25
PubMed Score 21.12
PubTator Score 14.27

Knowledge Summary

Patent (13,331)

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer -1.100 1.8e-02
breast carcinoma -2.700 3.0e-05
colon cancer 1.700 3.0e-02
ductal carcinoma in situ -2.700 6.0e-04
interstitial cystitis -1.300 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.200 1.3e-02
invasive ductal carcinoma -2.700 8.7e-03
lung cancer -2.400 2.8e-04
lung carcinoma -1.300 5.8e-07
malignant mesothelioma -1.700 1.6e-06
osteosarcoma -1.903 3.1e-03
pancreatic ductal adenocarcinoma liver m... 1.757 1.0e-02
psoriasis -1.100 5.4e-04

Gene RIF (16)

AA Sequence

MLSKVLPVLLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPE      1 - 70
ASRILNTILSNYDHKLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDIIFSQTWYDERLCYNDTFESL     71 - 140
VLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKDGKVLYTIRMTIDAGCSLHMLRFPMDSHSCP    141 - 210
LSFSSFSYPENEMIYKWENFKLEINEKNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYV    211 - 280
AFQNYVPSSVTTMLSWVSFWIKTESAPARTSLGITSVLTMTTLGTFSRKNFPRVSYITALDFYIAICFVF    281 - 350
CFCALLEFAVLNFLIYNQTKAHASPKLRHPRINSRAHARTRARSRACARQHQEAFVCQIVTTEGSDGEER    351 - 420
PSCSAQQPPSPGSPEGPRSLCSKLACCEWCKRFKKYFCMVPDCEGSTWQQGRLCIHVYRLDNYSRVVFPV    421 - 490
TFFFFNVLYWLVCLNL                                                          491 - 506
//

Text Mined References (27)

PMID Year Title