Property Summary

NCBI Gene PubMed Count 25
Grant Count 6
R01 Count 5
Funding $487,794.96
PubMed Score 19.24
PubTator Score 14.27

Knowledge Summary

Patent (13,331)

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
psoriasis -1.100 0.001
osteosarcoma -1.903 0.003
pancreatic ductal adenocarcinoma liver m... 1.757 0.010
intraductal papillary-mucinous neoplasm ... 1.200 0.013
colon cancer 1.700 0.030
lung cancer -2.400 0.000
breast carcinoma -2.700 0.000
interstitial cystitis -2.000 0.001
Breast cancer -1.100 0.018
lung carcinoma -1.300 0.000
ductal carcinoma in situ -2.700 0.001
invasive ductal carcinoma -2.700 0.009

Gene RIF (16)

PMID Text
25660468 This study showed that in male groups, the expression of GABRE was generally lower in schizophrenia cases compared to the control.
24737792 Data indicate that GABA(A) receptor subunit epsilon (GABRE) approximately miR-452 approximately miR-224 locus is downregulated and hypermethylated in prostate cancer and is a promising epigenetic candidate biomarker for prostate cancer diagnosis and prognosis.
24022508 GABRE protein levels were significantly increased in schizophrenia, major depressive disorder, and bipolar disorder patients' lateral cerebellum compared to controls.
21422964 single nucleotide polymorphisms studied in the GABRA4, GABRE, and GABRQ genes are not related to the risk for familial ET.
20609421 Using published alpha subunit data we identified two principal components labeled 'Decreasing' (alpha2, alpha5, beta1, gamma1 and gamma3) and 'Dynamic' (alpha1, alpha4, beta2 and gamma2) responsible for 84% of variation in GABA(A)R subunit development.
20468064 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19087248 Although GABRE genes did not show positive association, further studies are necessary to consider the role of other GABA receptor genes in migraine susceptibility
19087248 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLSKVLPVLLGILLILQSRVEGPQTESKNEASSRDVVYGPQPQPLENQLLSEETKSTETETGSRVGKLPE      1 - 70
ASRILNTILSNYDHKLRPGIGEKPTVVTVEISVNSLGPLSILDMEYTIDIIFSQTWYDERLCYNDTFESL     71 - 140
VLNGNVVSQLWIPDTFFRNSKRTHEHEITMPNQMVRIYKDGKVLYTIRMTIDAGCSLHMLRFPMDSHSCP    141 - 210
LSFSSFSYPENEMIYKWENFKLEINEKNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYV    211 - 280
AFQNYVPSSVTTMLSWVSFWIKTESAPARTSLGITSVLTMTTLGTFSRKNFPRVSYITALDFYIAICFVF    281 - 350
CFCALLEFAVLNFLIYNQTKAHASPKLRHPRINSRAHARTRARSRACARQHQEAFVCQIVTTEGSDGEER    351 - 420
PSCSAQQPPSPGSPEGPRSLCSKLACCEWCKRFKKYFCMVPDCEGSTWQQGRLCIHVYRLDNYSRVVFPV    421 - 490
TFFFFNVLYWLVCLNL                                                          491 - 506
//

Text Mined References (27)

PMID Year Title
25660468 2015 Sex differences in GABAergic gene expression occur in the anterior cingulate cortex in schizophrenia.
24737792 2014 Hypermethylation of the GABRE~miR-452~miR-224 promoter in prostate cancer predicts biochemical recurrence after radical prostatectomy.
24022508 2013 Expression of GABAA ?2-, ?1- and ?-receptors are altered significantly in the lateral cerebellum of subjects with schizophrenia, major depression and bipolar disorder.
21422964 2011 Gamma-aminobutyric acid GABRA4, GABRE, and GABRQ receptor polymorphisms and risk for essential tremor.
20609421 2010 Developmental co-regulation of the beta and gamma GABAA receptor subunits with distinct alpha subunits in the human dorsolateral prefrontal cortex.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19087248 2008 Investigation of gamma-aminobutyric acid (GABA) A receptors genes and migraine susceptibility.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19078961 2010 Strong genetic evidence for a selective influence of GABAA receptors on a component of the bipolar disorder phenotype.
More...