Property Summary

NCBI Gene PubMed Count 50
Grant Count 2
Funding $159,787.89
PubMed Score 44.74
PubTator Score 47.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.400 0.002
posterior fossa group B ependymoma -4.300 0.000
oligodendroglioma -2.300 0.004
glioblastoma -3.200 0.000
sonic hedgehog group medulloblastoma -4.000 0.000
atypical teratoid / rhabdoid tumor -2.400 0.007
medulloblastoma, large-cell -3.900 0.000
primitive neuroectodermal tumor -3.000 0.001
pediatric high grade glioma -3.200 0.000
lung carcinoma -1.100 0.000
psoriasis -1.400 0.000

Synonym

Accession P78333 B2R726 O60436 Q9BX27
Symbols

Gene

 Grant Application (2)

Gene RIF (37)

PMID Text
25999661 Results suggest a potential association between CRP and GPC5 variants with lung cancer risk; variation in GKN1 is associated with chemotherapy response in the Chinese Han population.
25818666 miR-709 may positively regulate invasion and metastasis of hepatocellular carcinoma through targeting GPC5.
24943672 gene variants in IRF5, IRF8 and GPC5 were not associated with risk of relapse or disease progression in multiple sclerosis
24682381 GPC5, a tumor suppressor, is regulated by miR-620 in lung adenocarcinoma.
24456789 Variants in the 50-upstream region of GPC5 confer risk of lung cancer in never smokers
24135429 These results indicate that GPC5 polymorphisms would be useful genetic indicators for Inflammatory demyelinating diseasess, including neuromyelitis optica and multiple sclerosis .
24130709 The IL7R, TNFRSF1A, and GPC5 polymorphisms tended to be associated with having a second event of Multiple sclerosis within a year.
23962560 Data suggest that glypican-5 (GPC5) is a metastasis suppressor gene in non-small cell lung cancer (NSCLC) and may be a potential biomarker that predicts NSCLC metastasis.
23867465 Shh binds to HSPG co-receptors containing a glypican 5 core and 2-O-sulfo-iduronic acid to promote neural precursor proliferation.
23223018 GPC5 is a gene required for normal neural tube development.
More...

AA Sequence

MDAQTWPVGFRCLLLLALVGSARSEGVQTCEEVRKLFQWRLLGAVRGLPDSPRAGPDLQVCISKKPTCCT      1 - 70
RKMEERYQIAARQDMQQFLQTSSSTLKFLISRNAAAFQETLETLIKQAENYTSILFCSTYRNMALEAAAS     71 - 140
VQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLEYSECIRMARRDVSPFGNIPQR    141 - 210
VMGQMGRSLLPSRTFLQALNLGIEVINTTDYLHFSKECSRALLKMQYCPHCQGLALTKPCMGYCLNVMRG    211 - 280
CLAHMAELNPHWHAYIRSLEELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVR    281 - 350
TPTQSPRCSFDQSKEKHGMKTTTRNSEETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWN    351 - 420
GEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQGRSPKPDKWELLQLGSGGGM    421 - 490
VEQVSGDCDDEDGCGGSGSGEVKRTLKITDWMPDDMNFSDVKQIHQTDTGSTLDTTGAGCAVATESMTFT    491 - 560
LISVVMLLPGIW                                                              561 - 572
//

Text Mined References (50)

PMID Year Title
25999661 2015 Polymorphisms in C-reactive protein and Glypican-5 are associated with lung cancer risk and Gartrokine-1 influences Cisplatin-based chemotherapy response in a Chinese Han population.
25818666 2015 miR-709 up-regulated in hepatocellular carcinoma, promotes proliferation and invasion by targeting GPC5.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
24943672 2014 Prediction of response to interferon therapy in multiple sclerosis.
24682381 2014 GPC5, a tumor suppressor, is regulated by miR-620 in lung adenocarcinoma.
24456789 2014 Variants in the 5'-upstream region of GPC5 confer risk of lung cancer in never smokers.
24135429 2013 Putative association of GPC5 polymorphism with the risk of inflammatory demyelinating diseases.
24130709 2013 Multiple sclerosis susceptibility genes: associations with relapse severity and recovery.
23962560 2013 Glypican-5 is a novel metastasis suppressor gene in non-small cell lung cancer.
More...