Property Summary

NCBI Gene PubMed Count 53
PubMed Score 45.70
PubTator Score 47.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -2.100 3.8e-03
astrocytic glioma -2.400 2.0e-03
atypical teratoid / rhabdoid tumor -2.400 6.7e-03
ependymoma -3.500 9.5e-04
glioblastoma -2.400 9.5e-05
group 3 medulloblastoma -3.800 8.5e-05
lung carcinoma -1.100 1.1e-06
medulloblastoma, large-cell -3.900 6.4e-05
oligodendroglioma -2.300 3.8e-03
primitive neuroectodermal tumor -3.000 6.1e-04
psoriasis -1.400 3.9e-14

 CSPA Cell Line (1)

Gene RIF (40)

AA Sequence

MDAQTWPVGFRCLLLLALVGSARSEGVQTCEEVRKLFQWRLLGAVRGLPDSPRAGPDLQVCISKKPTCCT      1 - 70
RKMEERYQIAARQDMQQFLQTSSSTLKFLISRNAAAFQETLETLIKQAENYTSILFCSTYRNMALEAAAS     71 - 140
VQEFFTDVGLYLFGADVNPEEFVNRFFDSLFPLVYNHLINPGVTDSSLEYSECIRMARRDVSPFGNIPQR    141 - 210
VMGQMGRSLLPSRTFLQALNLGIEVINTTDYLHFSKECSRALLKMQYCPHCQGLALTKPCMGYCLNVMRG    211 - 280
CLAHMAELNPHWHAYIRSLEELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVR    281 - 350
TPTQSPRCSFDQSKEKHGMKTTTRNSEETLANRRKEFINSLRLYRSFYGGLADQLCANELAAADGLPCWN    351 - 420
GEDIVKSYTQRVVGNGIKAQSGNPEVKVKGIDPVINQIIDKLKHVVQLLQGRSPKPDKWELLQLGSGGGM    421 - 490
VEQVSGDCDDEDGCGGSGSGEVKRTLKITDWMPDDMNFSDVKQIHQTDTGSTLDTTGAGCAVATESMTFT    491 - 560
LISVVMLLPGIW                                                              561 - 572
//

Text Mined References (53)

PMID Year Title