Property Summary

NCBI Gene PubMed Count 28
PubMed Score 55.82
PubTator Score 55.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma 1.130 3.0e-03
adult high grade glioma 1.700 2.8e-03
aldosterone-producing adenoma -1.011 9.6e-03
astrocytoma 1.300 8.6e-10
Atopic dermatitis 1.100 3.8e-03
atypical teratoid/rhabdoid tumor 1.500 1.4e-04
Breast cancer 3.400 3.7e-02
chronic rhinosinusitis -1.050 2.3e-02
colon cancer 1.800 3.5e-02
ductal carcinoma in situ 1.300 6.8e-04
ependymoma 1.300 4.6e-05
glioblastoma 1.800 8.0e-07
group 4 medulloblastoma 1.700 6.0e-04
lung cancer 1.700 1.2e-03
nasopharyngeal carcinoma 1.400 8.3e-05
non-small cell lung cancer 1.624 1.3e-15
oligodendroglioma 1.300 5.5e-11
pancreatic cancer 1.200 1.8e-03
pancreatic carcinoma 1.200 1.8e-03
psoriasis -1.700 4.9e-04

Gene RIF (8)

AA Sequence

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQ      1 - 70
PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFN     71 - 140
GEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAK    141 - 210
WYITDFVELLGELEE                                                           211 - 225
//

Text Mined References (31)

PMID Year Title