Property Summary

NCBI Gene PubMed Count 27
PubMed Score 53.11
PubTator Score 55.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
pancreatic cancer 1.200 0.002
psoriasis -1.700 0.000
astrocytoma 1.300 0.000
glioblastoma 1.800 0.000
oligodendroglioma 1.300 0.000
posterior fossa group B ependymoma 1.900 0.000
group 4 medulloblastoma 1.700 0.001
Atopic dermatitis 1.100 0.004
adrenocortical carcinoma 1.130 0.003
non-small cell lung cancer 1.624 0.000
colon cancer 1.800 0.035
lung cancer 1.700 0.001
Breast cancer 3.400 0.037
pediatric high grade glioma 2.000 0.000
atypical teratoid/rhabdoid tumor 1.500 0.000
pancreatic carcinoma 1.200 0.002
aldosterone-producing adenoma -1.011 0.010
nasopharyngeal carcinoma 1.400 0.000
ductal carcinoma in situ 1.300 0.001
chronic rhinosinusitis -1.050 0.023

Synonym

Accession P78330 B2RCR5 Q7Z3S5 PSP
Symbols PSP
PSPHD

Gene

PANTHER Protein Class (2)

PDB

1L8L   1L8O   1NNL  

Gene RIF (7)

PMID Text
25793315 We further uncovered that phosphoserine phosphatase (PSPH), the final rate-limiting enzyme of the SSP pathway, is critical for cMyc-driven cancer progression both in vitro and in vivo
25152457 phosphoserine phosphatase deficiency is associated with Neu-Laxova syndrome.
25080166 study of an intellectual disability family from Pakistan; identified a variant in PSPH: chr7:56088803C>T, NM_004577.3 c.103G>A; p.Ala35Thr (hg19) which segregated in homozygous form with the phenotype in both branches of the family
21726982 status of PSPH in normal skin epidermis and skin tumors along with its sub-cellular localization in epidermal keratinocytes and its requirement for squamous cell carcinoma proliferation
15291819 human phosphoserine phosphatase structure now shows a sevenfold coordinated Ca(2+) ion in the active site that might explain the inhibitory effect of Ca(2+) on the enzyme
12213811 description of the first crystal structures of the HPSP in complexes with the competitive inhibitor 2-amino-3-phosphonopropionic a
11752790 purification, crystallization and preliminary X-ray diffraction analysis

AA Sequence

MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQ      1 - 70
PSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFN     71 - 140
GEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAK    141 - 210
WYITDFVELLGELEE                                                           211 - 225
//

Text Mined References (30)

PMID Year Title
25793315 2015 cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions.
25152457 2014 Neu-Laxova syndrome is a heterogeneous metabolic disorder caused by defects in enzymes of the L-serine biosynthesis pathway.
25080166 2015 Phosphoserine phosphatase (PSPH) gene mutation in an intellectual disability family from Pakistan.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24651765 2014 Genome-wide meta-analysis of homocysteine and methionine metabolism identifies five one carbon metabolism loci and a novel association of ALDH1L1 with ischemic stroke.
21726982 2011 L-3-Phosphoserine phosphatase (PSPH) regulates cutaneous squamous cell carcinoma proliferation independent of L-serine biosynthesis.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...