Property Summary

NCBI Gene PubMed Count 52
Grant Count 18
R01 Count 5
Funding $1,263,788.27
PubMed Score 749.81
PubTator Score 76.29

Knowledge Summary

Patent

No data available

Expression

Gene RIF (42)

PMID Text
27039296 miR-720 is elevated in serum of patients with ADAM8-high TNBC and, in a group with other miRNAs downstream of ADAM8, holds promise as a biomarker for early detection of or treatment response of ADAM8-positive triple-negative breast cancer
26024798 ADAM8 promotes GC cell proliferation and invasion, and its expression is positively correlated with poor survival, indicating that it might be a promising target in GC therapy
25825051 ADAM8 causes temozolomide resistance in glioblastoma cells by enhancing pAkt/PI3K, pERK1/2, and cleavage of CD44 and HGF R/c-met
25629724 ADAM8 expression is associated with increased migration and invasiveness of pancreatic ductal adenocarcinoma cells.
25481287 ADAM8 and endostatin play a role in osteosarcoma progression.
25336660 N-glycosylation is essential for processing, localization, stability, and activity of ADAM8.
25098630 Results show that ADAM8 is overexpressed in colorectal cancer and promotes cell growth.
25010013 Data indicate that fibronectin fragments (FN-fs) are present in adult ntervertebral disc (IVD) from adult subjects, and ADAM-8, known to cleave FN, is present at the pericellular matrix of disc cells.
24526468 High ADAM8 expression is associated with pancreatic adenocarcinoma.
24375628 ADAM8 is abundantly expressed in breast tumors and derived metastases compared to normal tissue.
More...

AA Sequence

MRGLGLWLLGAMMLPAIAPSRPWALMEQYEVVLPWRLPGPRVRRALPSHLGLHPERVSYVLGATGHNFTL      1 - 70
HLRKNRDLLGSGYTETYTAANGSEVTEQPRGQDHCFYQGHVEGYPDSAASLSTCAGLRGFFQVGSDLHLI     71 - 140
EPLDEGGEGGRHAVYQAEHLLQTAGTCGVSDDSLGSLLGPRTAAVFRPRPGDSLPSRETRYVELYVVVDN    141 - 210
AEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARQRT    211 - 280
RRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQG    281 - 350
CRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVGGPVCGNLFVERGE    351 - 420
QCDCGPPEDCRNRCCNSTTCQLAEGAQCAHGTCCQECKVKPAGELCRPKKDMCDLEEFCDGRHPECPEDA    421 - 490
FQENGTPCSGGYCYNGACPTLAQQCQAFWGPGGQAAEESCFSYDILPGCKASRYRADMCGVLQCKGGQQP    491 - 560
LGRAICIVDVCHALTTEDGTAYEPVPEGTRCGPEKVCWKGRCQDLHVYRSSNCSAQCHNHGVCNHKQECH    561 - 630
CHAGWAPPHCAKLLTEVHAASGSLPVFVVVVLVLLAVVLVTLAGIIVYRKARSRILSRNVAPKTTMGRSN    631 - 700
PLFHQAASRVPAKGGAPAPSRGPQELVPTTHPGQPARHPASSVALKRPPPAPPVTVSSPPFPVPVYTRQA    701 - 770
PKQVIKPTFAPPVPPVKPGAGAANPGPAEGAVGPKVALKPPIQRKQGAGAPTAP                    771 - 824
//

Text Mined References (56)

PMID Year Title
27039296 2016 miR-720 is a downstream target of an ADAM8-induced ERK signaling cascade that promotes the migratory and invasive phenotype of triple-negative breast cancer cells.
26024798 2015 Upregulation of a disintegrin and metalloprotease 8 is associated with progression and prognosis of patients with gastric cancer.
25825051 2015 The metalloprotease-disintegrin ADAM8 contributes to temozolomide chemoresistance and enhanced invasiveness of human glioblastoma cells.
25629724 2015 ADAM8 as a drug target in pancreatic cancer.
25481287 2015 Expression of a disintegrin and metalloprotease 8 and endostatin in human osteosarcoma: implication in tumor progression and prognosis.
25336660 2014 N-glycosylation regulates ADAM8 processing and activation.
25098630 2014 Expression of A disintegrin and metalloprotease 8 is associated with cell growth and poor survival in colorectal cancer.
25010013 2014 Fibronectin fragments and the cleaving enzyme ADAM-8 in the degenerative human intervertebral disc.
24526468 2014 Anti-inflammatory macrophages activate invasion in pancreatic adenocarcinoma by increasing the MMP9 and ADAM8 expression.
24375628 2014 ADAM8 expression in invasive breast cancer promotes tumor dissemination and metastasis.
More...