Property Summary

NCBI Gene PubMed Count 98
Grant Count 161
R01 Count 88
Funding $15,111,396.36
PubMed Score 419.86
PubTator Score 155.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.700 0.000
psoriasis -1.200 0.000
osteosarcoma -2.473 0.000
glioblastoma -1.900 0.000
group 3 medulloblastoma -3.500 0.000
atypical teratoid / rhabdoid tumor -2.900 0.000
medulloblastoma, large-cell -4.600 0.000
primitive neuroectodermal tumor -2.400 0.000
non-small cell lung cancer -1.059 0.000
lung cancer -1.700 0.000
breast carcinoma -1.100 0.000
interstitial cystitis 1.400 0.000
pediatric high grade glioma -1.600 0.000
subependymal giant cell astrocytoma -1.321 0.037
lung adenocarcinoma -1.100 0.000
lung carcinoma -1.100 0.000
Breast cancer -1.700 0.000
gastric carcinoma 1.600 0.016
invasive ductal carcinoma -1.100 0.002
ulcerative colitis 1.500 0.000
ovarian cancer -3.400 0.000

Synonym

Accession P78324 A2A2E1 A8K411 B2R6C3 O00683 O43799 Q8N517 Q8TAL8 Q9H0Z2 Q9UDX2 Q9UIJ6 Q9Y4U9 SHP substrate 1
Symbols BIT
MFR
P84
SIRP
MYD-1
SHPS1
CD172A
PTPNS1

Gene

PDB

2JJS   2JJT   4CMM   2UV3   2WNG  

Gene RIF (66)

PMID Text
26573233 Data suggest a reduction in the CD47 antigen/signal-regulatory protein alpha (SIRPalpha) pathway by programmed cell death protein 1 (PD-1) blockade, which regulates Myeloid-derived suppressor cells (MDSCs) and tumor associated macrophages (TAMs).
26534964 the data suggest that combinatorial actions of ADAM10 and gamma-secretase on SIRPalpha cleavage promote inflammatory signaling.
26492885 exploited by Hepatitis E virus to negative regulated IFN-beta of the host innate immune system to promote viral infection
26116271 agents that block the CD47:SIRP-alpha engagement are attractive therapeutic targets as a monotherapy or in combination with additional immune-modulating agents for activating antitumor T cells in vivo
26085683 Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitate apoptotic cell clearance by macrophages.
25837251 Velcro" engineering of high affinity CD47 ectodomain as signal regulatory protein alpha (SIRPalpha) antagonists that enhance antibody-dependent cellular phagocytosis
24968096 Combinatorial expression of NKX2-5, SIRPA, VCAM1 and CD34 can be used to define discrete stages of cardiovascular cell lineage differentiation.
24550402 Polymorphisms in the human inhibitory signal-regulatory protein alpha do not affect binding to its ligand CD47.
24516072 negatively regulates neutrophil accumulation during inflammation
24511121 These results suggest that thrombospondin-1 binding to SIRP-alpha on nonphagocytic cells activates NADPH oxidase, limits vasodilation, and promotes renal ischemia reperfusion injury.
More...

AA Sequence

MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFR      1 - 70
GAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGT     71 - 140
ELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPVGESVSYSIH    141 - 210
STAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYP    211 - 280
QRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVS    281 - 350
AHPKEQGSNTAAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEKNAREI    351 - 420
TQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPE    421 - 490
PSFSEYASVQVPRK                                                            491 - 504
//

Text Mined References (104)

PMID Year Title
26573233 2015 PD-1 blockade attenuates immunosuppressive myeloid cells due to inhibition of CD47/SIRP? axis in HPV negative head and neck squamous cell carcinoma.
26534964 2015 Cleavage of Signal Regulatory Protein ? (SIRP?) Enhances Inflammatory Signaling.
26492885 2016 Hepatitis E virus infection activates signal regulator protein ? to down-regulate type I interferon.
26116271 2015 Molecular Pathways: Activating T Cells after Cancer Cell Phagocytosis from Blockade of CD47 "Don't Eat Me" Signals.
26085683 2015 Loss of Cell Surface CD47 Clustering Formation and Binding Avidity to SIRP? Facilitate Apoptotic Cell Clearance by Macrophages.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25837251 2015 "Velcro" engineering of high affinity CD47 ectodomain as signal regulatory protein ? (SIRP?) antagonists that enhance antibody-dependent cellular phagocytosis.
24968096 2014 SIRPA, VCAM1 and CD34 identify discrete lineages during early human cardiovascular development.
24550402 2014 Polymorphisms in the human inhibitory signal-regulatory protein ? do not affect binding to its ligand CD47.
24516072 2014 Signal regulatory protein alpha is present in several neutrophil granule populations and is rapidly mobilized to the cell surface to negatively fine-tune neutrophil accumulation in inflammation.
More...