Property Summary

NCBI Gene PubMed Count 100
PubMed Score 449.09
PubTator Score 155.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.300 7.9e-04
atypical teratoid / rhabdoid tumor -2.900 2.1e-07
Breast cancer -1.700 1.4e-09
breast carcinoma -1.100 2.9e-04
gastric carcinoma 1.600 1.6e-02
glioblastoma -1.400 2.0e-05
group 3 medulloblastoma -3.500 1.0e-09
interstitial cystitis 1.200 4.4e-03
invasive ductal carcinoma -1.100 1.8e-03
lung adenocarcinoma -1.100 2.4e-05
lung cancer -1.700 2.4e-04
lung carcinoma -1.100 3.7e-16
malignant mesothelioma -1.700 7.5e-07
medulloblastoma, large-cell -4.600 3.9e-08
non-small cell lung cancer -1.059 1.2e-10
osteosarcoma -2.473 5.9e-05
ovarian cancer -3.400 1.6e-17
primitive neuroectodermal tumor -2.400 3.6e-05
psoriasis -1.200 2.4e-04
subependymal giant cell astrocytoma -1.321 3.7e-02
ulcerative colitis 1.500 9.7e-05

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (68)

AA Sequence

MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFR      1 - 70
GAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGT     71 - 140
ELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDITLKWFKNGNELSDFQTNVDPVGESVSYSIH    141 - 210
STAKVVLTREDVHSQVICEVAHVTLQGDPLRGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYP    211 - 280
QRLQLTWLENGNVSRTETASTVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVS    281 - 350
AHPKEQGSNTAAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEKNAREI    351 - 420
TQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPE    421 - 490
PSFSEYASVQVPRK                                                            491 - 504
//

Text Mined References (106)

PMID Year Title