Property Summary

NCBI Gene PubMed Count 41
PubMed Score 215.78
PubTator Score 346.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer -1.400 1.7e-04
ovarian cancer -1.600 1.3e-05
primary pancreatic ductal adenocarcinoma -1.117 7.3e-04

 GO Component (2)

Gene RIF (15)

AA Sequence

MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEE      1 - 70
IASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTAN     71 - 140
SSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIES    141 - 210
IDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGAL    211 - 280
PDQGIAKAAPEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG               281 - 339
//

Text Mined References (49)

PMID Year Title