Property Summary

NCBI Gene PubMed Count 39
Grant Count 124
R01 Count 69
Funding $19,348,866.91
PubMed Score 214.36
PubTator Score 346.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.117 0.001
inflammatory breast cancer -1.400 0.000
ovarian cancer -1.600 0.000

Synonym

Accession P78318 Q8TAB2
Symbols IBP1
ALPHA-4

Gene

PANTHER Protein Class (1)

PDB

4IYP  

Gene RIF (14)

PMID Text
26876307 Data show that loss of epithelial membrane protein 2 (EMP2) is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1).
25876659 alpha4 is an important regulatory molecule of apoptosis and Bcl-xL phosphorylation induced by BCR crosslinking.
25207814 MID1 catalyzes the ubiquitination of protein phosphatase 2A and mutations within its Bbox1 domain disrupt polyubiquitination of alpha4 but not of PP2Ac in X-linked Opitz syndrome.
24388773 A potential important role of alpha4 in control of cell migration and/or invasion via the regulation of E-cadherin expression in bladder urothelial carcinoma.
24145130 the alpha4 N-terminus binding to endogenous PP2Ac and PABP, and the C-terminus to EDD, is reported.
22194938 The structure of alpha45 reveals two distinct surfaces, one that can interact with a negatively charged surface, which is present on PP2A, and one that interacts with the Bbox1 domain of MID1.
21454489 both the C-terminal Mid1-binding domain and the PP2Ac-binding determinants are required for Alpha4-mediated protection of PP2Ac from polyubiquitination and degradation.
21355954 IGBP-1 is expressed universally in advanced lung adenocarcinomas, and its overexpression is significantly related to outcome.
21339737 alpha4 is highly expressed in carcinogen-transformed human cells and primary human cancers.
20544796 Data show that in addition to PP2Ac, alpha4 interacts with EDD and PABP, suggesting its involvement in multiple steps in the mTOR pathway that leads to translation initiation and cell-cycle progression.
More...

AA Sequence

MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLDLFSRNEDLEE      1 - 70
IASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTAN     71 - 140
SSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVESGQADDERVREYYLLHLQRWIDISLEEIES    141 - 210
IDQEIKILRERDSSREASTSNSSRQERPPVKPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGAL    211 - 280
PDQGIAKAAPEEFRKAAQQQEEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG               281 - 339
//

Text Mined References (47)

PMID Year Title
26876307 2016 Epithelial membrane protein 2 regulates sphingosylphosphorylcholine-induced keratin 8 phosphorylation and reorganization: Changes of PP2A expression by interaction with alpha4 and caveolin-1 in lung cancer cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25876659 2015 Dominant negative form of alpha4 inhibits the BCR crosslinking-induced phosphorylation of Bcl-xL and apoptosis in an immature B cell line WEHI-231.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
25207814 2014 MID1 catalyzes the ubiquitination of protein phosphatase 2A and mutations within its Bbox1 domain disrupt polyubiquitination of alpha4 but not of PP2Ac.
24388773 2014 ?4 contributes to bladder urothelial carcinoma cell invasion and/or metastasis via regulation of E-cadherin and is a predictor of outcome in bladder urothelial carcinoma patients.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24145130 2014 Progestin-inducible EDD E3 ubiquitin ligase binds to ?4 phosphoprotein to regulate ubiquitination and degradation of protein phosphatase PP2Ac.
23892082 2013 A positive role of mammalian Tip41-like protein, TIPRL, in the amino-acid dependent mTORC1-signaling pathway through interaction with PP2A.
23591866 2013 Structural basis of protein phosphatase 2A stable latency.
More...