Property Summary

NCBI Gene PubMed Count 51
PubMed Score 77.11
PubTator Score 52.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.4e-04
ovarian cancer 8520 1.6e-04
breast carcinoma 1638 2.8e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.015 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.300 2.8e-03
ovarian cancer -1.300 1.6e-04
psoriasis 1.200 1.4e-04

Gene RIF (32)

AA Sequence

MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVIV      1 - 70
DERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEGATGLRPSGTVSCPICMDGYS     71 - 140
EIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI                        141 - 190
//

Text Mined References (59)

PMID Year Title