Property Summary

NCBI Gene PubMed Count 45
Grant Count 45
R01 Count 33
Funding $4,429,331.77
PubMed Score 74.69
PubTator Score 52.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.200 0.000
breast carcinoma 1.300 0.003
ovarian cancer -1.300 0.000

Gene RIF (26)

PMID Text
26450775 Data show that RNF4 is a SUMO-targeted ubiquitin ligase that targets TRF2 for ubiquitination.
26299341 RNF4 negatively regulates NF-kappaB signaling by down-regulating TAB2
25969536 novel insight into cross-talk between ubiquitin and SUMO and uncover USP11 and RNF4 as a balanced SUMO-targeted ubiquitin ligase/protease pair with a role in the DDR.
25960396 RNF4 enhances Ube2E1 self-ubiquitination.
25895136 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4
25751062 Cells lacking RNF4 exhibited interstrand cross-linker hypersensitivity. The gene encoding RNF4 was epistatic with the other genes encoding members of the FA/BRCA pathway.
25588990 RecQ-like helicase BLM subcellular localization is regulated by SUMO-targeted ubiquitin ligase RNF4 in response to DNA damage, presumably to prevent illegitimate recombination events.
25355316 RNF4 mediates ubiquitination and turnover of MeCP2 and thus derepresses transcription from DNA methylation.
24969970 NMR spectroscopy and biochemical characterization reveal how RNF4 manipulates the conformation of the SUMO chain, thereby facilitating optimal delivery of the distal SUMO domain for ubiquitin transfer.
24907272 the ARM dynamically regulates the SIM-dependent recruitment of targets to RNF4, which could be critical to dynamically fine-tune the abundance of Ser(P)-824-SUMO-KAP1 and, potentially, other SUMOylated proteins during DNA damage response.
More...

AA Sequence

MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVIV      1 - 70
DERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEGATGLRPSGTVSCPICMDGYS     71 - 140
EIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI                        141 - 190
//

Text Mined References (53)

PMID Year Title
26450775 2015 PIAS1-mediated sumoylation promotes STUbL-dependent proteasomal degradation of the human telomeric protein TRF2.
26299341 2015 RNF4 negatively regulates NF-?B signaling by down-regulating TAB2.
25969536 2015 Ubiquitin-specific Protease 11 (USP11) Deubiquitinates Hybrid Small Ubiquitin-like Modifier (SUMO)-Ubiquitin Chains to Counteract RING Finger Protein 4 (RNF4).
25960396 2015 RING E3-Catalyzed E2 Self-Ubiquitination Attenuates the Activity of Ube2E Ubiquitin-Conjugating Enzymes.
25895136 2015 c-Myc is targeted to the proteasome for degradation in a SUMOylation-dependent manner, regulated by PIAS1, SENP7 and RNF4.
25751062 2015 RNF4-mediated polyubiquitination regulates the Fanconi anemia/BRCA pathway.
25588990 2015 Disruption of SUMO-targeted ubiquitin ligases Slx5-Slx8/RNF4 alters RecQ-like helicase Sgs1/BLM localization in yeast and human cells.
25355316 2014 RING finger protein 4 (RNF4) derepresses gene expression from DNA methylation.
24969970 2014 Structural insight into SUMO chain recognition and manipulation by the ubiquitin ligase RNF4.
24907272 2014 An arginine-rich motif of ring finger protein 4 (RNF4) oversees the recruitment and degradation of the phosphorylated and SUMOylated Krüppel-associated box domain-associated protein 1 (KAP1)/TRIM28 protein during genotoxic stress.
More...