Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.29
PubTator Score 5.93

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -1.300 0.001
osteosarcoma -1.298 0.000
medulloblastoma, large-cell 1.500 0.002
colon cancer 1.100 0.018
lung cancer 1.300 0.002
group 3 medulloblastoma 1.700 0.000
ovarian cancer 1.400 0.000

Synonym

Accession P78316 D3DVR6 Q7LGI5 Q7Z6K0 Q8TBR6
Symbols UTP2
NOL14
C4orf9
RES425
RES4-25

Gene

Gene RIF (2)

PMID Text
26213846 NOP14 suppresses breast cancer progression by inhibiting NRIP1/Wnt/beta-catenin pathway.
22425761 our study provides new evidence for NOP14 in regulating PC cell proliferation and migration, and may provide new insights for clinical diagnosis and therapy.

AA Sequence

MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTL      1 - 70
LKEYKERDKSNVFRDKRFGEYNSNMSPEEKMMKRFALEQQRHHEKKSIYNLNEDEELTHYGQSLADIEKH     71 - 140
NDIVDSDSDAEDRGTLSAELTAAHFGGGGGLLHKKTQQEGEEREKPKSRKELIEELIAKSKQEKRERQAQ    141 - 210
REDALELTEKLDQDWKEIQTLLSHKTPKSENRDKKEKPKPDAYDMMVRELGFEMKAQPSNRMKTEAELAK    211 - 280
EEQEHLRKLEAERLRRMLGKDEDENVKKPKHMSADDLNDGFVLDKDDRRLLSYKDGKMNVEEDVQEEQSK    281 - 350
EASDPESNEEEGDSSGGEDTEESDSPDSHLDLESNVESEEENEKPAKEQRQTPGKGLISGKERAGKATRD    351 - 420
ELPYTFAAPESYEELRSLLLGRSMEEQLLVVERIQKCNHPSLAEGNKAKLEKLFGFLLEYVGDLATDDPP    421 - 490
DLTVIDKLVVHLYHLCQMFPESASDAIKFVLRDAMHEMEEMIETKGRAALPGLDVLIYLKITGLLFPTSD    491 - 560
FWHPVVTPALVCLSQLLTKCPILSLQDVVKGLFVCCLFLEYVALSQRFIPELINFLLGILYIATPNKASQ    561 - 630
GSTLVHPFRALGKNSELLVVSAREDVATWQQSSLSLRWASRLRAPTSTEANHIRLSCLAVGLALLKRCVL    631 - 700
MYGSLPSFHAIMGPLQALLTDHLADCSHPQELQELCQSTLTEMESQKQLCRPLTCEKSKPVPLKLFTPRL    701 - 770
VKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRKDNQFLARMQLSEIMERDAERKRKVKQLFNSL    771 - 840
ATQEGEWKALKRKKFKK                                                         841 - 857
//

Text Mined References (23)

PMID Year Title
26213846 2015 NOP14 suppresses breast cancer progression by inhibiting NRIP1/Wnt/?-catenin pathway.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382074 2013 A high-confidence interaction map identifies SIRT1 as a mediator of acetylation of USP22 and the SAGA coactivator complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22425761 2012 NOP14 promotes proliferation and metastasis of pancreatic cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...