Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.57
PubTator Score 5.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer 1.100 1.8e-02
group 3 medulloblastoma 1.700 1.1e-04
lung cancer 1.300 2.0e-03
medulloblastoma, large-cell 1.500 1.8e-03
osteosarcoma -1.298 4.0e-06
ovarian cancer 1.400 6.6e-05
psoriasis -1.300 1.4e-03

Gene RIF (3)

AA Sequence

MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTL      1 - 70
LKEYKERDKSNVFRDKRFGEYNSNMSPEEKMMKRFALEQQRHHEKKSIYNLNEDEELTHYGQSLADIEKH     71 - 140
NDIVDSDSDAEDRGTLSAELTAAHFGGGGGLLHKKTQQEGEEREKPKSRKELIEELIAKSKQEKRERQAQ    141 - 210
REDALELTEKLDQDWKEIQTLLSHKTPKSENRDKKEKPKPDAYDMMVRELGFEMKAQPSNRMKTEAELAK    211 - 280
EEQEHLRKLEAERLRRMLGKDEDENVKKPKHMSADDLNDGFVLDKDDRRLLSYKDGKMNVEEDVQEEQSK    281 - 350
EASDPESNEEEGDSSGGEDTEESDSPDSHLDLESNVESEEENEKPAKEQRQTPGKGLISGKERAGKATRD    351 - 420
ELPYTFAAPESYEELRSLLLGRSMEEQLLVVERIQKCNHPSLAEGNKAKLEKLFGFLLEYVGDLATDDPP    421 - 490
DLTVIDKLVVHLYHLCQMFPESASDAIKFVLRDAMHEMEEMIETKGRAALPGLDVLIYLKITGLLFPTSD    491 - 560
FWHPVVTPALVCLSQLLTKCPILSLQDVVKGLFVCCLFLEYVALSQRFIPELINFLLGILYIATPNKASQ    561 - 630
GSTLVHPFRALGKNSELLVVSAREDVATWQQSSLSLRWASRLRAPTSTEANHIRLSCLAVGLALLKRCVL    631 - 700
MYGSLPSFHAIMGPLQALLTDHLADCSHPQELQELCQSTLTEMESQKQLCRPLTCEKSKPVPLKLFTPRL    701 - 770
VKVLEFGRKQGSSKEEQERKRLIHKHKREFKGAVREIRKDNQFLARMQLSEIMERDAERKRKVKQLFNSL    771 - 840
ATQEGEWKALKRKKFKK                                                         841 - 857
//

Text Mined References (24)

PMID Year Title