Property Summary

NCBI Gene PubMed Count 51
PubMed Score 94.11
PubTator Score 74.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.300 2.1e-19
osteosarcoma 2.093 2.1e-08

 OMIM Phenotype (1)

Gene RIF (27)

AA Sequence

MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYYFKSSTSASPQ      1 - 70
GAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKSWMALLRREIGHFHEKKDLPL     71 - 140
DTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDEDDSYLEPDSPEPGRLEDALMHPPAYPPPPVP    141 - 210
TPRKPAFSDMPRAHSFTSKGPGPLLPPPPPKHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDP    211 - 280
PLSTMPTAPGLRKPPCFRESASPSPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPP    281 - 350
PVPANKPKFLKIAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDG    351 - 420
QSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNS    421 - 490
STKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGP    491 - 560
R//

Text Mined References (55)

PMID Year Title