Property Summary

NCBI Gene PubMed Count 113
PubMed Score 277.65
PubTator Score 393.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 5.7392062675538E-10
ovarian cancer 8492 4.33279520344307E-7
group 4 medulloblastoma 1875 1.90680719673667E-6
facioscapulohumeral dystrophy 286 3.26103682853745E-6
posterior fossa group B ependymoma 1530 1.2489343265919E-5
interstitial cystitis 2299 4.93821358749358E-5
atypical teratoid / rhabdoid tumor 4369 1.68162120559833E-4
lung cancer 4473 2.30690264636832E-4
glioblastoma 5572 3.03900950270724E-4
psoriasis 6685 9.55735897399864E-4
primitive neuroectodermal tumor 3031 0.00213059650539644
medulloblastoma, large-cell 6234 0.00220785874626101
Breast cancer 3099 0.00308711536737652
diabetes mellitus 1663 0.00315586035655341
interstitial lung disease 292 0.00361292370298188
primary Sjogren syndrome 789 0.0074786776483566
ductal carcinoma in situ 1745 0.00964211256675547
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.019510754364847
spina bifida 1064 0.0295636884553033
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0300591168281643
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0323042993164777
chronic kidney disease 90 0.0356099858680912
cutaneous lupus erythematosus 1056 0.0370488200961204
astrocytic glioma 2241 0.037367391697915
gastric carcinoma 832 0.0440183759546988
Disease Target Count Z-score Confidence
Myocarditis 17 4.759 2.4
Dilated cardiomyopathy 51 3.505 1.8
Cancer 2346 3.472 1.7

Expression

Synonym

Accession P78310 B2R8V8 B7WPI3 D3YHP0 O00694 Q8WWT6 Q8WWT7 Q8WWT8 Q9UKV4 CAR
Symbols CAR
HCAR
CAR4/6

Gene

PDB

1EAJ   1F5W   1JEW   1KAC   1P69   1P6A   1RSF   2J12   2J1K   2NPL   2W9L   2WBW   3J6L   3J6M   3J6N   3J6O  

  Ortholog (11)

 CSPA Cell Line (3)

Gene RIF (83)

PMID Text
25674795 Glycan microarray, flow cytometry, surface plasmon resonance and ELISA analyses reveal that the terminal knob domain of the long fiber (52LFK) binds to CAR, and the knob domain of the short fiber (52SFK) binds to sialylated glycoproteins.
25661872 Combining CAR activation with limited beta-catenin activation induces tumorigenesis, and the tumours share a conserved gene expression signature with beta-catenin-positive human hepatocellular carcinoma.
25605010 Lovastatin enhances adenovirus-mediated TRAIL induced apoptosis by depleting cholesterol of lipid rafts and affecting CAR and death receptor expression of prostate cancer cells.
25497012 Subsequent experiments also proved that both the rno-miR-466d and the human hsa-miR-466, which are orthologs of the miR-467 gene family, could effectively down-regulate the levels of rat and human CAR protein expression, respectively
25459915 CAR might play a role in adipose tissue dysfunction, given its dual associations with adipogenic and inflammatory genes.
25118298 Suggest that distinct forms of CAR play different roles in the undifferentiated state and tight junction formation of human embryos and embryonic stem cells.
24623425 Kinetic analyses show that the apparent first-order rate constant for the inactivation of coxsackievirus B3 by soluble CAR (sCAR) at physiological temperatures varies nonlinearly with sCAR concentration.
24316867 This study shows for the first time that lovastatin reduces the expression of CAR and subsequently the replication of CVB3 in human umbilical vein endothelial cells.
24291282 novel modifier of ventricular conduction and arrhythmia vulnerability in the setting of myocardial ischemia
24096322 CAR regulates epithelial cell junction stability through control of E-cadherin trafficking.
More...

AA Sequence

MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQV      1 - 70
IILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVK     71 - 140
PSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTY    141 - 210
SCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIRED    211 - 280
VPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGA    281 - 350
IPVMIPAQSKDGSIV                                                           351 - 365
//

Text Mined References (124)

PMID Year Title
25674795 2015 Human adenovirus 52 uses sialic acid-containing glycoproteins and the coxsackie and adenovirus receptor for binding to target cells.
25661872 2015 Activating CAR and ?-catenin induces uncontrolled liver growth and tumorigenesis.
25605010 2015 Lovastatin enhances adenovirus-mediated TRAIL induced apoptosis by depleting cholesterol of lipid rafts and affecting CAR and death receptor expression of prostate cancer cells.
25497012 2015 miR-466 is putative negative regulator of Coxsackie virus and Adenovirus Receptor.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25459915 2015 Coxsackie and adenovirus receptor is increased in adipose tissue of obese subjects: a role for adenovirus infection?
25118298 2014 CAR expression in human embryos and hESC illustrates its role in pluripotency and tight junctions.
24623425 2014 Kinetic and structural analysis of coxsackievirus B3 receptor interactions and formation of the A-particle.
24316867 2014 Effect of lovastatin on coxsackievirus B3 infection in human endothelial cells.
24291282 2014 Coxsackie and adenovirus receptor is a modifier of cardiac conduction and arrhythmia vulnerability in the setting of myocardial ischemia.
More...