Property Summary

NCBI Gene PubMed Count 118
PubMed Score 284.92
PubTator Score 393.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

 CSPA Cell Line (3)

Gene RIF (87)

AA Sequence

MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQV      1 - 70
IILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVK     71 - 140
PSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTY    141 - 210
SCTVRNRVGSDQCLLRLNVVPPSNKAGLIAGAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIRED    211 - 280
VPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGA    281 - 350
IPVMIPAQSKDGSIV                                                           351 - 365
//

Text Mined References (129)

PMID Year Title