Property Summary

NCBI Gene PubMed Count 166
PubMed Score 271.15
PubTator Score 219.60

Knowledge Summary

Patent

No data available

Expression

Gene RIF (56)

AA Sequence

MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLT      1 - 70
SLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVAS     71 - 140
ALSSRYH                                                                   141 - 147
//

Text Mined References (173)

PMID Year Title