Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $19,372
PubMed Score 3.00
PubTator Score 1.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.900 0.007
ependymoma 2.000 0.003
oligodendroglioma 2.000 0.002
osteosarcoma 1.896 0.000
pancreatic ductal adenocarcinoma liver m... 1.514 0.001
Pick disease 1.200 0.000
acute myeloid leukemia 1.100 0.025
ovarian cancer -1.100 0.001

Gene RIF (3)

PMID Text
26188124 veratridine enhances transactivation of UBXN2A, resulting in upregulation of UBXN2A in the cytoplasm, where UBXN2A binds and inhibits the oncoprotein mortalin-2
24625977 Suggest UBXN2A can reconstitute inactive p53-dependent apoptotic pathways in colonic neoplasms.
22454508 Ubx2 and Ubxd8 regulates lipid droplet homeostasis.

AA Sequence

MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQVDVNIKLWKN      1 - 70
GFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKKNEICLSTKPVFQPFSGQGHRL     71 - 140
GSATPKIVSKAKNIEVENKNNLSAVPLNNLEPITNIQIWLANGKRIVQKFNITHRVSHIKDFIEKYQGSQ    141 - 210
RSPPFSLATALPVLRLLDETLTLEEADLQNAVIIQRLQKTASFRELSEH                         211 - 259
//

Text Mined References (12)

PMID Year Title
26188124 2015 A plant alkaloid, veratridine, potentiates cancer chemosensitivity by UBXN2A-dependent inhibition of an oncoprotein, mortalin-2.
24625977 2014 Ubiquitin-like (UBX)-domain-containing protein, UBXN2A, promotes cell death by interfering with the p53-Mortalin interactions in colon cancer cells.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22454508 2012 The ubiquitin-like (UBX)-domain-containing protein Ubx2/Ubxd8 regulates lipid droplet homeostasis.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21326311 2011 Genome-wide association study identifies genetic variants influencing F-cell levels in sickle-cell patients.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...