Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 2.58695302872555E-6 |
Pick disease | 1893 | 3.87019924219387E-5 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 7.03676626315426E-4 |
ovarian cancer | 8492 | 9.75515047179525E-4 |
oligodendroglioma | 2849 | 0.00173349176004977 |
ependymoma | 2514 | 0.00336245050457732 |
astrocytic glioma | 2241 | 0.00747717935264453 |
acute myeloid leukemia | 785 | 0.0252678878498747 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | 1.900 | 0.007 |
ependymoma | 2.000 | 0.003 |
oligodendroglioma | 2.000 | 0.002 |
osteosarcoma | 1.896 | 0.000 |
pancreatic ductal adenocarcinoma liver m... | 1.514 | 0.001 |
Pick disease | 1.200 | 0.000 |
acute myeloid leukemia | 1.100 | 0.025 |
ovarian cancer | -1.100 | 0.001 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG |
Zebrafish | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26188124 | veratridine enhances transactivation of UBXN2A, resulting in upregulation of UBXN2A in the cytoplasm, where UBXN2A binds and inhibits the oncoprotein mortalin-2 |
24625977 | Suggest UBXN2A can reconstitute inactive p53-dependent apoptotic pathways in colonic neoplasms. |
22454508 | Ubx2 and Ubxd8 regulates lipid droplet homeostasis. |
MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQVDVNIKLWKN 1 - 70 GFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKKNEICLSTKPVFQPFSGQGHRL 71 - 140 GSATPKIVSKAKNIEVENKNNLSAVPLNNLEPITNIQIWLANGKRIVQKFNITHRVSHIKDFIEKYQGSQ 141 - 210 RSPPFSLATALPVLRLLDETLTLEEADLQNAVIIQRLQKTASFRELSEH 211 - 259 //
PMID | Year | Title |
---|---|---|
26188124 | 2015 | A plant alkaloid, veratridine, potentiates cancer chemosensitivity by UBXN2A-dependent inhibition of an oncoprotein, mortalin-2. |
24625977 | 2014 | Ubiquitin-like (UBX)-domain-containing protein, UBXN2A, promotes cell death by interfering with the p53-Mortalin interactions in colon cancer cells. |
23251661 | 2012 | Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population. |
22454508 | 2012 | The ubiquitin-like (UBX)-domain-containing protein Ubx2/Ubxd8 regulates lipid droplet homeostasis. |
21900206 | 2011 | A directed protein interaction network for investigating intracellular signal transduction. |
21326311 | 2011 | Genome-wide association study identifies genetic variants influencing F-cell levels in sickle-cell patients. |
19197348 | 2009 | Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae. |
17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
15815621 | 2005 | Generation and annotation of the DNA sequences of human chromosomes 2 and 4. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
More... |