Property Summary

NCBI Gene PubMed Count 27
PubMed Score 7.11
PubTator Score 10.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession P68402 A8DPS5 A8DPS6 A8DPS7 E9PEJ5 E9PLP3 O00687 Q29459 Q6IBR6
Symbols HEL-S-303

Gene

PDB

1VYH  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
492953 screening 4161 / 0 / 331300 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (PAFAH1B2)
492971 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (PAFAH1B2)
493034 screening 2171 / 0 / 250 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of human platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (PAFAH1B2)

Gene RIF (11)

PMID Text
25945974 PAFAH1B2 and 1B3 are important in maintaining cancer pathogenicity across a wide spectrum of cancer types.
25034894 The R92H and I198T polymorphisms are highly related to the plasma PAF-AH levels and the risk of coronary heart disease, especially among patients with blood stasis syndrome.
23508960 aspirin is hydrolyzed in plasma by two enzymes, BChE and a new extracellular form of platelet-activating factor acetylhydrolase, PAFAH1b2.
23238734 Knockdown of PAFAH1B2 strongly reduced Abeta secretion from human cells, and this effect was confirmed in primary cells derived from PAFAH1B2 knock-out mice
21866060 Plasma PAF-AH can hydrolyze oxidized phospholipids, and may attenuate the spreading of lipid peroxidation and participate in defense mechanisms against vasospasm after aneurysmal subarachnoid hemorrhage.
21844189 intracellular type I PAF acetylhydrolase (PAFAH1B2 and PAFAH1B3) is the major aspirin hydrolase of human blood
19622634 These results indicate an antagonistic effect of alpha1, alpha2 and Ndel1 for Lis1 binding, probably to modulate dynein functions in vivo.
19019335 Observational study of gene-disease association. (HuGE Navigator)
18155631 splice variants of the Pafah1b2 gene transcript retain exons 1-5 and replace exon 6 with alternative exons derived from genomic sequence 3' to exon 6. Splice variants encode two proteins with different novel carboxy termini
17849047 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN      1 - 70
FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL     71 - 140
PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH    141 - 210
ELIMQLLEETPEEKQTTIA                                                       211 - 229
//

Text Mined References (34)

PMID Year Title
25945974 2015 Activity-Based Protein Profiling of Oncogene-Driven Changes in Metabolism Reveals Broad Dysregulation of PAFAH1B2 and 1B3 in Cancer.
25034894 2014 Associations of platelet-activating factor acetylhydrolase (PAF-AH) gene polymorphisms with circulating PAF-AH levels and risk of coronary heart disease or blood stasis syndrome in the Chinese Han population.
23508960 2013 Aspirin hydrolysis in plasma is a variable function of butyrylcholinesterase and platelet-activating factor acetylhydrolase 1b2 (PAFAH1b2).
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23238734 2012 Loss of PAFAH1B2 reduces amyloid-? generation by promoting the degradation of amyloid precursor protein C-terminal fragments.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
21866060 2012 Plasma platelet-activating factor-acetyl hydrolase activity and the levels of free forms of biomarker of lipid peroxidation in cerebrospinal fluid of patients with aneurysmal subarachnoid hemorrhage.
21844189 2011 Intracellular erythrocyte platelet-activating factor acetylhydrolase I inactivates aspirin in blood.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...