Property Summary

Ligand Count 1
NCBI Gene PubMed Count 27
PubMed Score 6.77
PubTator Score 10.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.012 2.8e-06
juvenile dermatomyositis 1.016 9.8e-13
lung cancer 1.400 6.0e-04
ovarian cancer -1.600 3.3e-06
pancreatic cancer 1.300 1.4e-03
primary pancreatic ductal adenocarcinoma 1.334 9.3e-04
tuberculosis and treatment for 6 months 1.100 1.5e-03

Gene RIF (11)

AA Sequence

MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN      1 - 70
FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL     71 - 140
PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH    141 - 210
ELIMQLLEETPEEKQTTIA                                                       211 - 229
//

Text Mined References (34)

PMID Year Title