Property Summary

NCBI Gene PubMed Count 497
Grant Count 81
R01 Count 67
Funding $6,869,993.85
PubMed Score 370.04
PubTator Score 369.76

Knowledge Summary

Patent (14,378)

Expression

  Differential Expression (8)

Synonym

Accession P68400 B4DYS6 D3DVV8 P19138 P20426 Q14013 Q5U065 CK II alpha
Symbols CKII
CK2A1
OCNDS
CSNK2A3

Gene

PDB

1JWH   4DGL   4MD7   4MD8   4MD9   4NH1   3PE4   3TAX   4GYW   4GYY   4GZ3   3U87   1NA7   1PJK   2PVR   2ZJW   3AMY   3AT2   3AT3   3AT4   3AXW   3BQC   3C13   3FWQ   3H30   3JUH   3MB6   3MB7   3NGA   3NSZ   3OWJ   3OWK   3OWL   3PE1   3PE2   3Q04   3Q9W   3Q9X   3Q9Y   3Q9Z   3QA0   3R0T   3RPS   3U4U   3U9C   3W8L   3WAR   3WIK   3WIL   3WOW   4FBX   4GRB   4GUB   4IB5   4KWP   4RLL   4UB7   4UBA   5B0X   5CLP   5CQU   5CQW   5CS6   5CSH   5CSP   5CSV   5CU3   5CU4   5CU6   5CVF   5CVG   5CVH   5H8B   5H8E   5H8G  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (267)

PMID Text
26732432 This study report increased levels of CK2 in the hippocampus and temporal cortex of AD patients compared to non-demented controls.
26703694 Protein kinase CK2 expression predicts relapse survival in ERalpha dependent breast cancer, and modulates ERalpha expression in vitro.
26663086 Data suggest that complexes of HDAC3-H1.3 with NCOR1 and NCOR2/SMRT accumulate on chromatin in synchronized HeLa cells in late G2 phase and mitosis; deacetylation activity of HDAC3 is activated via phosphorylation of Ser-424 by CK2 only in mitosis.
26562283 Data suggest that cryptochromes mediate periodic binding of Ck2b (casein kinase 2beta) to Bmal1 (aryl hydrocarbon receptor nuclear translocator-like protein) and thus inhibit Bmal1-Ser90 phosphorylation by Ck2a (casein kinase 2alpha). [SYNOPSIS]
26543229 CK2-increased ECE-1c protein stability is related to augmented migration and invasion of colon cancer cells, shedding light on a novel mechanism by which CK2 may promote malignant progression of this disease.
26349539 Inhibition of ecto-CK2 by K137-E4 is accompanied by a slower migration of cancer cells as judged by wound healing assays
26219304 High casein kinase II expression is associated with B-cell acute lymphoblastic leukemia.
26172393 CK2-mediated phosphorylation of ARC contributed to chemotherapy resistance by inhibiting DOX induced apoptosis; combining DOX with CK2 inhibitor could induce apoptosis of cancer cells synergistically by down-regulating the phosphorylation of ARC
26165401 The combination treatment of TRAIL and the CK2 inhibitor decreased p65 nuclear translocation... the treatment of a sub-dose of TRAIL, downregulation of CK2, using both genetic and pharmacological approaches .
26160174 There is a major role of the CK2alpha-interacting protein CKIP-1 in activation of PAK1 for neoplastic prostate cells transformation.
More...

AA Sequence

MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL      1 - 70
KPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEI     71 - 140
LKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYD    141 - 210
YSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKR    211 - 280
WERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSAN    281 - 350
MMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ                                 351 - 391
//

Text Mined References (508)

PMID Year Title
26732432 2016 Increased occurrence of protein kinase CK2 in astrocytes in Alzheimer's disease pathology.
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
26703694 2015 Protein Kinase CK2 Expression Predicts Relapse Survival in ER? Dependent Breast Cancer, and Modulates ER? Expression in Vitro.
26663086 2016 Mitotic Activation of a Novel Histone Deacetylase 3-Linker Histone H1.3 Protein Complex by Protein Kinase CK2.
26562283 2015 A New Role Discovered for a Well-Known Clock Protein.
26543229 2015 Colon cancer cell invasion is promoted by protein kinase CK2 through increase of endothelin-converting enzyme-1c protein stability.
26349539 2015 Design, validation and efficacy of bisubstrate inhibitors specifically affecting ecto-CK2 kinase activity.
26219304 2015 Targeting casein kinase II restores Ikaros tumor suppressor activity and demonstrates therapeutic efficacy in high-risk leukemia.
26172393 2015 Phosphorylation of apoptosis repressor with caspase recruitment domain by protein kinase CK2 contributes to chemotherapy resistance by inhibiting doxorubicin induced apoptosis.
26165401 2015 Suppression of casein kinase 2 sensitizes tumor cells to antitumor TRAIL therapy by regulating the phosphorylation and localization of p65 in prostate cancer.
More...