Property Summary

Ligand Count 177
NCBI Gene PubMed Count 523
PubMed Score 377.73
PubTator Score 369.76

Knowledge Summary

Patent (14,378)

Expression

  Differential Expression (8)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 3.5e-03
lung cancer 1.100 5.4e-03
medulloblastoma, large-cell 1.200 2.2e-05
non-small cell lung cancer 1.139 1.7e-17
osteosarcoma 1.567 5.9e-05
ovarian cancer 2.200 2.2e-05
Rheumatoid arthritis 1.600 1.8e-02
sonic hedgehog group medulloblastoma 1.100 5.3e-04

Synonym

Accession P68400 B4DYS6 D3DVV8 P19138 P20426 Q14013 Q5U065 CK II alpha
Symbols CKII
Cka1
Cka2
CK2A1
OCNDS
CSNK2A3

Gene

PDB

1JWH   4DGL   4MD7   4MD8   4MD9   4NH1   3PE4   3TAX   4GYW   4GYY   4GZ3   5HGV   5VIE   5VIF   3U87   1NA7   1PJK   2PVR   2ZJW   3AMY   3AT2   3AT3   3AT4   3AXW   3BQC   3C13   3FWQ   3H30   3JUH   3MB6   3MB7   3NGA   3NSZ   3OWJ   3OWK   3OWL   3PE1   3PE2   3Q04   3Q9W   3Q9X   3Q9Y   3Q9Z   3QA0   3R0T   3RPS   3U4U   3U9C   3W8L   3WAR   3WIK   3WIL   3WOW   4FBX   4GRB   4GUB   4IB5   4KWP   4RLL   4UB7   4UBA   5B0X   5CLP   5CQU   5CQW   5CS6   5CSH   5CSP   5CSV   5CT0   5CTP   5CU0   5CU2   5CU3   5CU4   5CU6   5CVF   5CVG   5CVH   5CX9   5H8B   5H8E   5H8G   5KU8   5KWH   5M44   5M4C   5M4F   5M4I   5MMF   5MMR   5MO5   5MO6   5MO7   5MO8   5MOD   5MOE   5MOH   5MOT   5MOV   5MOW   5MP8   5MPJ   5N1V   5NQC  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (279)

AA Sequence

MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKIL      1 - 70
KPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEI     71 - 140
LKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYD    141 - 210
YSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKR    211 - 280
WERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSAN    281 - 350
MMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ                                 351 - 391
//

Text Mined References (534)

PMID Year Title