Property Summary

NCBI Gene PubMed Count 43
PubMed Score 6.79
PubTator Score 147.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.637 0.003
intraductal papillary-mucinous carcinoma... 1.200 0.003
breast carcinoma 1.200 0.005
diabetes mellitus -1.400 0.005
nasopharyngeal carcinoma -1.400 0.000
ovarian cancer 2.400 0.000

Synonym

Accession P68371 A2BFA2 P05217
Symbols Beta2
TUBB2
TUBB2C

Gene

Gene RIF (18)

PMID Text
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22264600 The results od this study found that betaI-tubulin protein expression was decreased in the anterior cingulate cortex and increased in the dorsolateral prefrontal cortex, but not changed in superior temporal gyrus or hippocampus in schizophrenia.
22174317 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
20872967 Data suggest that increased expression of hnRNP A1, Ezrin, tubulin beta-2C and Annexin A1 in SLNMM indicate a significantly elevated early colorectal cancer metastasis.
19996274 Studies show that BFBTS bound and modified beta-tubulin at residue Cys12, forming beta-tubulin-SS-fluorobenzyl.
18613978 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
18384219 Annexin II and beta(2)-tubulin down-regulation is important in nasopharyngeal carcinoma formation and may represent potential targets for further investigations.
17360745 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
17360745 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
More...

AA Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATAEEEGEFEEEAEEEVA                                                 421 - 445
//

Text Mined References (52)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22264600 2012 Regional differences in expression of ?-tubulin isoforms in schizophrenia.
21630459 2011 Proteomic characterization of the human sperm nucleus.
More...