Property Summary

Ligand Count 11
NCBI Gene PubMed Count 45
PubMed Score 8.09
PubTator Score 147.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.200 4.8e-03
diabetes mellitus -1.400 4.9e-03
intraductal papillary-mucinous carcinoma... 1.200 2.9e-03
Multiple myeloma 1.637 2.7e-03
nasopharyngeal carcinoma -1.300 7.0e-05
ovarian cancer 2.400 5.3e-06

Gene RIF (18)

AA Sequence

MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEP      1 - 70
GTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLG     71 - 140
GGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDI    141 - 210
CFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQ    211 - 280
YRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK    281 - 350
TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS    351 - 420
EYQQYQDATAEEEGEFEEEAEEEVA                                                 421 - 445
//

Text Mined References (54)

PMID Year Title