Property Summary

Ligand Count 1
NCBI Gene PubMed Count 88
PubMed Score 29.66
PubTator Score 28.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Condyloma acuminatum 7
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -2.000 6.9e-05
astrocytic glioma -1.800 5.0e-03
Astrocytoma, Pilocytic -2.600 6.8e-11
atypical teratoid / rhabdoid tumor -2.700 8.7e-11
Breast cancer 1.300 1.4e-10
breast carcinoma 1.300 2.2e-03
colon cancer 1.100 4.2e-04
dermatomyositis 1.200 4.0e-03
Down syndrome -1.100 3.2e-02
ependymoma -2.000 2.3e-02
gastric carcinoma 1.100 4.3e-02
glioblastoma -1.800 7.0e-07
group 3 medulloblastoma -2.200 1.0e-04
intraductal papillary-mucinous adenoma (... 1.800 5.6e-04
intraductal papillary-mucinous carcinoma... 2.200 8.3e-04
intraductal papillary-mucinous neoplasm ... 2.700 1.5e-03
medulloblastoma, large-cell -1.300 7.2e-03
mucosa-associated lymphoid tissue lympho... 1.119 2.5e-02
oligodendroglioma -1.600 2.4e-14
osteosarcoma -3.507 4.8e-06
ovarian cancer 1.400 1.7e-03
pancreatic cancer 1.300 4.0e-06
pancreatic ductal adenocarcinoma liver m... 1.288 3.4e-02
Pick disease -1.200 2.5e-02
primitive neuroectodermal tumor -2.400 8.0e-08

Protein-protein Interaction (6)

Gene RIF (30)

AA Sequence

MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDL      1 - 70
EPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHS     71 - 140
FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE    351 - 420
AREDMAALEKDYEEVGIDSYEDEDEGEE                                              421 - 448
//

Text Mined References (99)

PMID Year Title