Property Summary

NCBI Gene PubMed Count 84
Grant Count 6
R01 Count 5
Funding $1,043,142.75
PubMed Score 29.57
PubTator Score 28.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (33)

PMID Text
26465396 In conclusion, our current results did not find an association between TUBA4A and ALS in Chinese patients, and further studies will be required.
26103986 Data show that overexpression of the 14-3-3sigma isoform resulted in a disruption of the tubulin cytoskeleton mediated by binding Tau protein.
25893256 This study mutational screening revealed the presence of four novel heterozygous variants of TUBA4A mutation in four sporadic amyotrophic lateral sclerosis.
25374358 TUBA4A mutants destabilize the microtubule network, diminishing its repolymerization capability
24268707 TUBA4A is significantly increased in spermatazoa from men with azoospermia.
23826228 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDL      1 - 70
EPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHS     71 - 140
FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE    351 - 420
AREDMAALEKDYEEVGIDSYEDEDEGEE                                              421 - 448
//

Text Mined References (95)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26465396 2015 TUBA4A may not be a significant genetic factor in Chinese ALS patients.
26103986 2015 Involvement of 14-3-3 in tubulin instability and impaired axon development is mediated by Tau.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25893256 2015 TUBA4A gene analysis in sporadic amyotrophic lateral sclerosis: identification of novel mutations.
25374358 2014 Exome-wide rare variant analysis identifies TUBA4A mutations associated with familial ALS.
24906155 2014 Molecular basis for age-dependent microtubule acetylation by tubulin acetyltransferase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24268707 2014 Acetylated ?-tubulin is reduced in individuals with poor sperm motility.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...