Property Summary

NCBI Gene PubMed Count 84
PubMed Score 29.57
PubTator Score 28.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Condyloma acuminatum 7
Disease Target Count P-value
oligodendroglioma 2849 2.36120367163831E-14
posterior fossa group B ependymoma 1530 6.70228683170418E-13
pilocytic astrocytoma 3086 4.09925922127409E-11
atypical teratoid / rhabdoid tumor 4369 8.70504941127992E-11
Breast cancer 3099 1.37680639610337E-10
sonic hedgehog group medulloblastoma 1482 1.91677697440823E-8
primitive neuroectodermal tumor 3031 7.97549534647917E-8
glioblastoma 5572 6.95230022534861E-7
pancreatic cancer 2300 3.99294032829758E-6
osteosarcoma 7933 4.80126404768859E-6
adult high grade glioma 2148 6.8537920475326E-5
ovarian cancer 8492 7.23297521439077E-5
colon cancer 1475 4.22631202385088E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.58200676850945E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.2727988371518E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00148328602844882
breast carcinoma 1614 0.00219012349185964
dermatomyositis 967 0.00404801974419437
astrocytic glioma 2241 0.00496982140785263
medulloblastoma, large-cell 6234 0.00715536164528008
mucosa-associated lymphoid tissue lymphoma 480 0.0251176678704188
Pick disease 1893 0.0254055041176997
Down syndrome 548 0.0315192844649685
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0338680902575099
gastric carcinoma 832 0.0428903290984484
Disease Target Count Z-score Confidence
Mixed glioma 1 3.099 1.5

Expression

Synonym

Accession P68366 A8MUB1 B3KNQ6 P05215
Symbols ALS22
TUBA1
H2-ALPHA

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig EggNOG Inparanoid
Opossum OMA EggNOG
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (28)

PMID Text
26465396 In conclusion, our current results did not find an association between TUBA4A and ALS in Chinese patients, and further studies will be required.
26103986 Data show that overexpression of the 14-3-3sigma isoform resulted in a disruption of the tubulin cytoskeleton mediated by binding Tau protein.
25893256 This study mutational screening revealed the presence of four novel heterozygous variants of TUBA4A mutation in four sporadic amyotrophic lateral sclerosis.
25374358 TUBA4A mutants destabilize the microtubule network, diminishing its repolymerization capability
24268707 TUBA4A is significantly increased in spermatazoa from men with azoospermia.
23826228 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22174317 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
21167302 Tandem affinity purification and mass spectrometry analysis identify tubulin alpha 4a protein (TUBA4A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
More...

AA Sequence

MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDL      1 - 70
EPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHS     71 - 140
FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE    351 - 420
AREDMAALEKDYEEVGIDSYEDEDEGEE                                              421 - 448
//

Text Mined References (95)

PMID Year Title
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
26465396 2015 TUBA4A may not be a significant genetic factor in Chinese ALS patients.
26103986 2015 Involvement of 14-3-3 in tubulin instability and impaired axon development is mediated by Tau.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25893256 2015 TUBA4A gene analysis in sporadic amyotrophic lateral sclerosis: identification of novel mutations.
25374358 2014 Exome-wide rare variant analysis identifies TUBA4A mutations associated with familial ALS.
24906155 2014 Molecular basis for age-dependent microtubule acetylation by tubulin acetyltransferase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24268707 2014 Acetylated ?-tubulin is reduced in individuals with poor sperm motility.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...