Property Summary

NCBI Gene PubMed Count 54
Grant Count 5
R01 Count 5
Funding $508,153.6
PubMed Score 40.10
PubTator Score 329.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
inflammatory breast cancer 1.100 0.000

Gene RIF (36)

PMID Text
26996302 Taken together our data provide valuable information regarding the interaction of CK1delta and a-tubulin and a novel approach for the development of pharmacological tools to inhibit proliferation of cancer cells.
25328666 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
24814981 NAD-dependent regulation of alpha-tubulin acetylation is mediated by SIRT2.
24760594 Results suggest that lithium chloride (LiCl) treatments activate alpha-tubulin N-acetyltransferase 1 (alphaTAT1) by the inhibition of glycogen synthase kinase 3 beta (GSK-3beta) and promote the alpha-tubulin acetylation, and then elongate the primary cilia.
23826228 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
23767669 Data indicate that the derivatives exhibited much better potency to inhibit tubulin polymerization but a decreased activity to inhibit Hsp27 chaperone function.
23625295 Increased TUBA1B expression is associated with poor overall survival in hepatocellular carcinoma.
23235160 ARHGAP21 is a Rho-GAP involved in cell-cell junction remodeling that affects migration and EMT through alpha-tubulin interaction and acetylation
22944692 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
22174317 HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type
More...

AA Sequence

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDL      1 - 70
EPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHS     71 - 140
FGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIY    141 - 210
DICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEK    211 - 280
AYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTG    281 - 350
FKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE    351 - 420
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY                                           421 - 451
//

Text Mined References (62)

PMID Year Title
26996302 2016 New potential peptide therapeutics perturbing CK1?/?-tubulin interaction.
26972003 2016 ?-Tubulin Tyrosination and CLIP-170 Phosphorylation Regulate the Initiation of Dynein-Driven Transport in Neurons.
26875866 2016 Graded Control of Microtubule Severing by Tubulin Glutamylation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25908662 2015 Mitosis. Microtubule detyrosination guides chromosomes during mitosis.
25416956 2014 A proteome-scale map of the human interactome network.
24906155 2014 Molecular basis for age-dependent microtubule acetylation by tubulin acetyltransferase.
24814981 2014 Regulation of SIRT2-dependent ?-tubulin deacetylation by cellular NAD levels.
24760594 2015 The elongation of primary cilia via the acetylation of ?-tubulin by the treatment with lithium chloride in human fibroblast KD cells.
24021646 2013 Overexpression, purification, and functional analysis of recombinant human tubulin dimer.
More...