Property Summary

Ligand Count 9
NCBI Gene PubMed Count 36
PubMed Score 114.17
PubTator Score 84.76

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P68106 Q13664 Q16645 Q53TM2 Q9BQ40 PPIase FKBP1B
Symbols OTK4
FKBP1L
PKBP1L
PPIase
FKBP12.6

Gene

PANTHER Protein Class (1)

PDB

1C9H   4C02   4IQ2   4IQC   5HKG   5L1D   5T15   5T9M   5T9N   5T9R   5T9S   5T9V   5TA3   5TAL   5TAM   5TAN   5TAP   5TAQ   5TAS   5TAT   5TAU   5TAV   5TAW   5TAX   5TAY   5TAZ   5TB0   5TB1   5TB2   5TB3   5TB4  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (22)

AA Sequence

MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLG      1 - 70
QRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE                                     71 - 108
//

Text Mined References (37)

PMID Year Title