Property Summary

NCBI Gene PubMed Count 34
Grant Count 104
R01 Count 80
Funding $12,434,254.01
PubMed Score 108.55
PubTator Score 84.76

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P68106 Q13664 Q16645 Q53TM2 Q9BQ40 PPIase FKBP1B
Symbols OTK4
FKBP1L
PKBP1L
PPIase
FKBP12.6

Gene

PANTHER Protein Class (1)

PDB

1C9H   3J8E   4C02   4IQ2   4IQC  

Gene RIF (20)

PMID Text
26009186 How phosphorylation of RyR affects channel activity and whether proteins such as the FK-506 binding proteins (FKBP12 and FKBP12.6) are involved in heart failure
26009182 RyRs have been identified as important targets of FKBP12 and FKBP12.6, members of the immunophilin family
23887639 Sirolimus-FKBP12.6 impairs endothelial barrier function by activation of protein kinase C-alpha and downstream disruption of the p120-VE cadherin interaction in vascular endothelium.
22236651 These data corroborate other studies suggesting that mutations in FKBP12 and FKBP12.6 genes are not commonly related to cardiac diseases.
22087651 FKBP12.6-deficient mice with cardiac hypertrophy do not display exercise-induced arrhythmia and/or sudden cardiac death.
20431056 Characterize the kinetics of FKBP12/12.6 binding to RyR2 in ventricular myocytes and effects on calcium signaling.
20404344 analysis of the ryanodine receptor FK506-binding protein subunit
19226252 The findings suggest that FKBP12.6 regulation of RyR2 is unlikely to be the primary defect in inherited arrhythmogenic cardiac disease.
17921453 the loss of FKBP12.6 has no significant effect on the conduction and activation of RyR2 or the propensity for spontaneous Ca(2+) release and stress-induced ventricular arrhythmias
17506935 Results describe abrupt changes in the expression of FKBP12.6, SERCA2a, PKA, and ECE on reperfusion against ischemia, which are responsible for the rapid occurrence of ventricular fibrillation, and their prevention by CPU86017.
More...

AA Sequence

MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQMSLG      1 - 70
QRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE                                     71 - 108
//

Text Mined References (35)

PMID Year Title
26009186 2015 The ryanodine receptor provides high throughput Ca2+-release but is precisely regulated by networks of associated proteins: a focus on proteins relevant to phosphorylation.
26009182 2015 Bcl-2 and FKBP12 bind to IP3 and ryanodine receptors at overlapping sites: the complexity of protein-protein interactions for channel regulation.
25416956 2014 A proteome-scale map of the human interactome network.
23887639 2013 Sirolimus-FKBP12.6 impairs endothelial barrier function through protein kinase C-? activation and disruption of the p120-vascular endothelial cadherin interaction.
23233753 2013 In cardiomyocytes, binding of unzipping peptide activates ryanodine receptor 2 and reciprocally inhibits calmodulin binding.
22236651 2012 A negative screen for mutations in calstabin 1 and 2 genes in patients with dilated cardiomyopathy.
22087651 2011 Transgenic analysis of the role of FKBP12.6 in cardiac function and intracellular calcium release.
20431056 2010 Kinetics of FKBP12.6 binding to ryanodine receptors in permeabilized cardiac myocytes and effects on Ca sparks.
20404344 2010 Mapping the ryanodine receptor FK506-binding protein subunit using fluorescence resonance energy transfer.
19226252 2009 FKBP12.6 binding of ryanodine receptors carrying mutations associated with arrhythmogenic cardiac disease.
More...