Property Summary

NCBI Gene PubMed Count 146
PubMed Score 1274.64
PubTator Score 427.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P68104 P04719 P04720 Q6IQ15 EF-1-alpha-1
Symbols CCS3
EF1A
PTI1
CCS-3
EE1A1
EEF-1
EEF1A
EF-Tu
LENG7
eEF1A-1
GRAF-1EF
HNGC:16303

Gene

PDB

3C5J   1SYW  

Gene RIF (95)

PMID Text
26819305 These results suggest that miR-33a-5p is downregulated during Japanese encephalitis virus infection, which contributes to viral replication by increasing the intracellular level of EEF1A1, an interaction partner of the viral NS3 and NS5 proteins.
26624286 The combined evidence indicates a direct interaction between eEF1A and reverse transcriptase is crucial for HIV reverse transcription and replication
26551858 Study found reduced levels of hippocampal eEF1A protein in Alzheimer's disease
26545399 Data indicate that the methylation of lysine (Lys) in elongation factor 1A (eEF1A) by methyltransferase is conserved from yeast to human.
26497934 ROCK phosphorylated eEF1A1 is a novel substrate for TIMAP-PP1 underlining the complex regulatory role of TIMAP in the endothelium.
26397839 These results suggest that the antitumor effects of paclitaxel in breast cancer are mediated by activation of the AMPK/EF1alpha/FOXO3a signaling pathway.
26242867 eEF1A interacts with 5'UTR of HIV-1 genomic RNA and the interaction is important for late DNA synthesis in reverse transcription.
26212729 Our results provide novel information on the intracellular distribution and interaction of eEF1A isoforms.
26102086 eEF1A-1 protein was induced by high palmitate, and partially re-localized from its predominant location at the ER to polymerized actin at the cell periphery, coinciding with the onset of ER stress.
25893434 Low expression of eEF1A1 was associated with cervical squamous cell carcinoma.
More...

AA Sequence

MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERG      1 - 70
ITIDISLWKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGVGEFEAGISKNGQTREHALLA     71 - 140
YTLGVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPW    141 - 210
FKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF    211 - 280
APVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHP    281 - 350
GQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPP    351 - 420
LGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK                                421 - 462
//

Text Mined References (150)

PMID Year Title
26819305 2016 MicroRNA-33a-5p Modulates Japanese Encephalitis Virus Replication by Targeting Eukaryotic Translation Elongation Factor 1A1.
26624286 2015 Specific Interaction between eEF1A and HIV RT Is Critical for HIV-1 Reverse Transcription and a Potential Anti-HIV Target.
26551858 2016 Impaired Eukaryotic Elongation Factor 1A Expression in Alzheimer's Disease.
26545399 2016 Novel N-terminal and Lysine Methyltransferases That Target Translation Elongation Factor 1A in Yeast and Human.
26497934 2015 Elongation factor-1A1 is a novel substrate of the protein phosphatase 1-TIMAP complex.
26397839 2015 Paclitaxel suppresses the viability of breast tumor MCF7 cells through the regulation of EF1? and FOXO3a by AMPK signaling.
26242867 2015 Binding of the eukaryotic translation elongation factor 1A with the 5'UTR of HIV-1 genomic RNA is important for reverse transcription.
26212729 2015 New insights on the interaction between the isoforms 1 and 2 of human translation elongation factor 1A.
26102086 2015 Elongation Factor 1A-1 Is a Mediator of Hepatocyte Lipotoxicity Partly through Its Canonical Function in Protein Synthesis.
25893434 2015 Differentially expressed proteins among normal cervix, cervical intraepithelial neoplasia and cervical squamous cell carcinoma.
More...