Property Summary

NCBI Gene PubMed Count 80
PubMed Score 58.40
PubTator Score 70.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 4.9e-05
lung cancer 1.200 1.2e-02
malignant mesothelioma 1.300 1.2e-06
osteosarcoma -1.315 2.3e-04
ovarian cancer -1.300 1.7e-07
tuberculosis and treatment for 6 months -1.100 3.0e-02

Gene RIF (26)

AA Sequence

MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITF      1 - 70
KTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNA     71 - 140
EEFTKKYGEKRPVD                                                            141 - 154
//

Text Mined References (87)

PMID Year Title