Property Summary

NCBI Gene PubMed Count 79
Grant Count 29
R01 Count 28
Funding $2,392,090.58
PubMed Score 53.65
PubTator Score 70.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -1.315 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
tuberculosis and treatment for 6 months -1.100 0.030
lung cancer 1.200 0.012
ovarian cancer 2.000 0.000

Gene RIF (26)

PMID Text
27094594 The TCGGC haplotype is associated with an increased risk of Hashimoto Thyroiditis(HT) and UBE2L3 gene is likely to be a susceptibility factor to HT in a Chinese Han population.
25640675 UBE2L3 polymorphism amplifies NF-kappaB activation and promotes plasma cell development, linking linear ubiquitination to multiple autoimmune diseases.
25483588 The MAP1B-LC1 could interact with the ubiquitin-conjugating E2 enzyme UBE2L3 and that the ubiquitination/degradation mechanism triggered by MAP1B-LC1 could be prevented by inhibiting the ubiquitin-proteasome proteolytic pathway.
25422456 UbcH7 has a role in regulating 53BP1 stability and DSB repair
24906799 together with UBE2N and UBE2D2, synergistically contribute to Parkin-mediated mitophagy
24566975 An interaction between LC1 and the ubiquitin-conjugating enzyme UBE2L3.
24162738 Importance of HLA-C and UBE2L3 in the clearance of HBV infection in addition to HLA-DP and HLA-DQ.
24091983 Report role of UBE2L3 genetic variants in confering risk of systemic lupus erythematosus in Chinese population.
22476155 The results suggest that variants carried on the SLE-associated UBE2L3 risk haplotype influence autoimmunity by modulating UBCH7 expression.
22308380 Crystal structures of two bacterial E3s, Salmonella SopA and Escherichia coli NleL, both in complex with human E2 UbcH7, are reported.
More...

AA Sequence

MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITF      1 - 70
KTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNA     71 - 140
EEFTKKYGEKRPVD                                                            141 - 154
//

Text Mined References (84)

PMID Year Title
27565346 2016 Two Distinct Types of E3 Ligases Work in Unison to Regulate Substrate Ubiquitylation.
27094594 2016 The haplotype of UBE2L3 gene is associated with Hashimoto's thyroiditis in a Chinese Han population.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25640675 2015 UBE2L3 polymorphism amplifies NF-?B activation and promotes plasma cell development, linking linear ubiquitination to multiple autoimmune diseases.
25483588 2014 The MAP1B-LC1/UBE2L3 complex catalyzes degradation of cell surface CaV2.2 channels.
25422456 2014 UbcH7 regulates 53BP1 stability and DSB repair.
24906799 2014 The ubiquitin-conjugating enzymes UBE2N, UBE2L3 and UBE2D2/3 are essential for Parkin-dependent mitophagy.
24566975 2014 CaV2.2 channel cell surface expression is regulated by the light chain 1 (LC1) of the microtubule-associated protein B (MAP1B) via UBE2L3-mediated ubiquitination and degradation.
24446487 2014 E2~Ub conjugates regulate the kinase activity of Shigella effector OspG during pathogenesis.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
More...