Property Summary

NCBI Gene PubMed Count 105
PubMed Score 161.86
PubTator Score 40.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 0.0 5.0
Restrictive cardiomyopathy 11 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 5.394 2.7
Atrial heart septal defect 18 0.0 4.0

Expression

  Differential Expression (13)

Gene RIF (79)

AA Sequence

MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK      1 - 70
YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA     71 - 140
VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI    141 - 210
VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT    211 - 280
YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS    281 - 350
LSTFQQMWISKQEYDEAGPSIVHRKCF                                               351 - 377
//

Text Mined References (107)

PMID Year Title