Property Summary

NCBI Gene PubMed Count 36
PubMed Score 37.41
PubTator Score 24.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (10)

AA Sequence

MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERL      1 - 70
ATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGEL     71 - 140
ERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTV    141 - 210
AKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI                                    211 - 248
//

Text Mined References (44)

PMID Year Title