Property Summary

NCBI Gene PubMed Count 32
PubMed Score 33.30
PubTator Score 24.46

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
23812729 Data indicate the upregulation of tropomyosin-4 in infiltrating ductal breast carcinomas (IDCAs) tissues, which may suggest its involvement in breast cancer development.
23792823 In addition to CLIC1 and TPM1, which were the proteins initially discovered in a xenograft mouse model, CLIC4, TPM2, TPM3, and TPM4 were present in ovarian cancer patient sera at significantly elevated levels compared with controls.
22537621 Plasma peroxiredoxins 1 and 2, and tropomyosin 4 were shown to associate with asbestos-exposure, and peroxiredoxin 1 with lung cancer.
21373848 TPM4, PDIA and SRC8 were also localized to the trophoblast cells, further highlighting the importance of these cytoskeletal remodelling proteins in early pregnancy
21119665 Low TPM4 expression in the cytoplasm is associated with uterine cervix carcinogenesis.
20381070 This protein has been found differentially expressed in the anterior cingulate cortex from patients with schizophrenia
17968984 Tm4-defined cytoskeleton is a marker of growth and repair/regeneration in response to injury, disease state and stress in skeletal muscle.

AA Sequence

MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERL      1 - 70
ATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGEL     71 - 140
ERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTV    141 - 210
AKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI                                    211 - 248
//

Publication (40)

PMID Year Title
25369766 2015 A systematic nomenclature for mammalian tropomyosin isoforms.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23812729 2013 Tropomyosin-4 correlates with higher SBR grades and tubular differentiation in infiltrating ductal breast carcinomas: an immunohistochemical and proteomics-based study.
23792823 2013 Protein isoform-specific validation defines multiple chloride intracellular channel and tropomyosin isoforms as serological biomarkers of ovarian cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22537621 2012 Peroxiredoxins and tropomyosins as plasma biomarkers for lung cancer and asbestos exposure.
22423221 2012 A meta-analysis and genome-wide association study of platelet count and mean platelet volume in african americans.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...