Property Summary

NCBI Gene PubMed Count 182
PubMed Score 527.39
PubTator Score 343.99

Knowledge Summary

Patent (1,184)

Expression

Gene RIF (92)

AA Sequence

MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSD      1 - 70
LIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKC     71 - 140
MDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSP    141 - 210
VKTIR                                                                     211 - 215
//

Text Mined References (197)

PMID Year Title