Property Summary

NCBI Gene PubMed Count 176
Grant Count 2
Funding $171,578
PubMed Score 508.57
PubTator Score 343.99

Knowledge Summary

Patent (1,184)

Expression

Synonym

Accession P67870 B0UXA9 P07312 P13862 Q4VX47 CK II beta
Symbols G5A
CK2B
CK2N
CSK2B

Gene

PANTHER Protein Class (2)

 Grant Application (2)

PDB

1DS5   1JWH   1QF8   3EED   4DGL   4MD7   4MD8   4MD9   4NH1  

Gene RIF (96)

PMID Text
26562283 Data suggest that cryptochromes mediate periodic binding of Ck2b (casein kinase 2beta) to Bmal1 (aryl hydrocarbon receptor nuclear translocator-like protein) and thus inhibit Bmal1-Ser90 phosphorylation by Ck2a (casein kinase 2alpha). [SYNOPSIS]
26562092 Data suggest that cryptochromes (Cry1 and Cry2) mediate periodic binding of Ck2b (casein kinase 2beta) to Bmal1 (aryl hydrocarbon receptor nuclear translocator-like protein) and thus inhibit Bmal1-Ser90 phosphorylation by Ck2a (casein kinase 2alpha).
26108355 AMPKalpha signalling suppresses EMT and secretion of chemokines in renal tubular epithelia through interaction with CK2beta to attenuate renal injury.
25788269 CK2 is widely expressed in follicular, Burkitt and diffuse large B-cell lymphomas and may have role in malignant B-cell growth.
25486430 we propose that Foxc2 is functionally maintained in the cytoplasm of normal epithelial cells by CK2alpha/alpha'-mediated phosphorylation at serine 124, which is dependent on proper targeting of the holoenzyme via the CK2b regulatory subunit.
24216761 ARKL1 binds CK2beta through the KSSR motif and this involves a polyserine sequence resembling the CK2beta binding sequence in EBNA1.
24175891 Asymmetric alpha2beta2 tetramers of casein kinase 2 are organized in trimeric rings that correspond to inactive forms of the enzyme. The new crystal structures presented here reveal the symmetric architecture of the isolated active tetramers.
23816881 The study identifies casein kinase 2 as an NRF1-binding protein and finds that the knockdown of casein kinase 2 enhances the Nrf1-dependent expression of the proteasome subunit genes.
23599180 CK2alpha' exhibits a striking preference for caspase-3 phosphorylation in cells as compared to CK2alpha and that CK2beta exhibits the capacity to abolish caspase-3 phosphorylation
23580615 Data indicate that protein S phosphorylation by casein kinase 1 (CK1) and casein kinase 2 (CK2) increased activated proten C cofactor activity.
More...

AA Sequence

MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSD      1 - 70
LIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKC     71 - 140
MDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSP    141 - 210
VKTIR                                                                     211 - 215
//

Text Mined References (191)

PMID Year Title
26711270 2015 A Novel Interaction of Ecdysoneless (ECD) Protein with R2TP Complex Component RUVBL1 Is Required for the Functional Role of ECD in Cell Cycle Progression.
26562283 2015 A New Role Discovered for a Well-Known Clock Protein.
26562092 2015 CRY Drives Cyclic CK2-Mediated BMAL1 Phosphorylation to Control the Mammalian Circadian Clock.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26108355 2015 AMPK?2 reduces renal epithelial transdifferentiation and inflammation after injury through interaction with CK2?.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25788269 2015 Protein kinase CK2 is widely expressed in follicular, Burkitt and diffuse large B-cell lymphomas and propels malignant B-cell growth.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25519132 2014 An AUTS2-Polycomb complex activates gene expression in the CNS.
More...