Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.67
PubTator Score 5.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 1.100 1.0e-28
Astrocytoma, Pilocytic 1.100 2.3e-07
atypical teratoid / rhabdoid tumor 1.200 8.4e-06
dermatomyositis 1.400 2.3e-04
ependymoma 1.100 1.3e-12
glioblastoma 1.400 5.2e-10
group 3 medulloblastoma 1.200 9.3e-04
intraductal papillary-mucinous neoplasm ... -1.100 1.0e-03
medulloblastoma, large-cell 1.100 3.4e-05
Multiple myeloma 1.682 3.4e-04
oligodendroglioma 1.100 2.9e-11
ovarian cancer -1.500 1.3e-03
pediatric high grade glioma 1.100 3.6e-06
primitive neuroectodermal tumor 1.100 1.5e-04
psoriasis -1.200 1.7e-04
subependymal giant cell astrocytoma 1.370 5.4e-03
Waldenstrons macroglobulinemia 1.186 6.2e-03

 GO Process (1)

Protein-protein Interaction (2)

Gene RIF (2)

AA Sequence

MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLT      1 - 70
NRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVG     71 - 140
RARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE                                   141 - 179
//

Text Mined References (21)

PMID Year Title