Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.12
PubTator Score 5.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 1.37082504368354E-16
oligodendroglioma 2849 2.91751124964523E-11
atypical teratoid/rhabdoid tumor 1095 3.07755656647445E-9
pediatric high grade glioma 2712 6.30270824463573E-9
pilocytic astrocytoma 3086 1.91516139113348E-8
ovarian cancer 8492 9.40923428470344E-7
group 3 medulloblastoma 2254 3.93218975356464E-6
medulloblastoma, large-cell 6234 3.37769681652221E-5
glioblastoma 5572 1.01000249863895E-4
Multiple myeloma 1328 1.19390111568052E-4
primitive neuroectodermal tumor 3031 1.53330450667019E-4
psoriasis 6685 1.70963637898177E-4
dermatomyositis 967 2.33133523372786E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0010287610603488
astrocytoma 1493 0.00204197804685595
Waldenstrons macroglobulinemia 765 0.00379024201512048
subependymal giant cell astrocytoma 2287 0.00542891045816426
Disease Target Count Z-score Confidence
Hepatoid adenocarcinoma 2 3.999 2.0

Expression

  Differential Expression (17)

Synonym

Accession P67812 B2RAD7 B4DUL4 H0YK72 H0YK83 O75957 P21378 Q53FQ8
Symbols SPC18
SPCS4A
SEC11L1
sid2895
1810012E07Rik

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GO Process (1)

Gene RIF (1)

PMID Text
23995782 SPC18 contributes to malignant progression through promotion of TGF-alpha secretion in gastric cancer.

AA Sequence

MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLT      1 - 70
NRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVG     71 - 140
RARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE                                   141 - 179
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23995782 2014 Signal peptidase complex 18, encoded by SEC11A, contributes to progression via TGF-? secretion in gastric cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
19261089 2009 Transcriptome dissection of gastric cancer: identification of novel diagnostic and therapeutic targets from pathology specimens.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
More...