Property Summary

NCBI Gene PubMed Count 207
PubMed Score 113.34
PubTator Score 166.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 2.02064809958925E-18
lung adenocarcinoma 2714 5.35920753762841E-7
medulloblastoma, large-cell 6234 1.92483792146662E-5
tuberculosis and treatment for 6 months 686 2.02515619824775E-5
Multiple myeloma 1328 1.48147303956599E-4
glioblastoma 5572 2.13448028856156E-4
psoriasis 6685 2.31030894876244E-4
ovarian cancer 8492 2.60653403649018E-4
atypical teratoid / rhabdoid tumor 4369 2.7316201887793E-4
pediatric high grade glioma 2712 0.00144972620587238
osteosarcoma 7933 0.00223656463543597
hereditary spastic paraplegia 313 0.00590583259259905
subependymal giant cell astrocytoma 2287 0.0129505024511964
aldosterone-producing adenoma 664 0.0172040333770243
astrocytic glioma 2241 0.0369835585018279
Waldenstrons macroglobulinemia 765 0.0388250779184467
Disease Target Count Z-score Confidence
Cancer 2346 3.058 1.5

Expression

  Differential Expression (16)

Synonym

Accession P67775 P05323 P13197 PP2A-alpha
Symbols RP-C
PP2Ac
PP2CA
PP2Calpha

Gene

PDB

3C5W   4I5L   4I5N   3P71   3DW8   3FGA   4LAC   2IAE   2NPP   2NYL   2NYM   4IYP   2IE3   2IE4   3K7V   3K7W  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (117)

PMID Text
26876307 Data show that loss of epithelial membrane protein 2 (EMP2) is involved in sphingosylphosphorylcholine (SPC)-induced phosphorylation of keratin 8 (K8) via ubiquitination of protein phosphatase 2 (PP2A) through alpha4 phosphoprotein by caveolin-1 (cav-1).
26592247 Both PP-1 and PP-2A are directly involved in regulating eye development, and are aberrantly expressed in cataract and glaucoma patients. (Review)
26575017 Data show that downregulating proto-oncogene protein Akt (p-Akt) by inhibiting PP2A inhibitor SET-mediated protein phosphatase 2A (PP2A) inactivation determined the pro-apoptotic effects of EMQA and paclitaxel combination treatment.
26563471 Data suggest a critical role for the I2PP2A protein (SET)-protein phosphatase-2A (PP2A) signaling axis in Pten protein (Pten) deficient castration resistant prostate cancer (CRPC) progression.
26378614 that loss of glucocerebrosidase function may contribute to SNCA accumulation through inhibition of autophagy via PPP2A inactivation
26310906 Concurrent mTORC1 inactivation and PP2A-B55alpha stimulation fuel ULK1-dependent autophagy.
26234767 Alterations affecting PP2A subunits together with the deregulation of endogenous PP2A inhibitors such as CIP2A and SET have been described as contributing mechanisms to inactivate PP2A in prostate cancer.
26053095 Data show that the protein phosphatase 2A (PP2A)/c-jun N-Terminal Kinase (JNK)/Sp1 transcription factor/CDK1 kinase pathway and the autophagy/cyclin kinase inhibitor p21 pathway participated in G2/M cell cycle arrest triggered by PP2A inhibitors.
25979969 Data suggest that activation of TAZ (tafazzin) inhibits adipogenesis in mesenchymal stem cells; interaction of TAZ and protein phosphatases (PP1A, PP2A) up-regulates dephosphorylation and transport of TAZ to cell nucleus.
25956027 Binding of calmodulin changes the calcineurin regulatory region to a less dynamic conformation.
More...

AA Sequence

MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR      1 - 70
IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA     71 - 140
NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG    141 - 210
ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD    211 - 280
TLKYSFLQFDPAPRRGEPHVTRRTPDYFL                                             281 - 309
//

Text Mined References (213)

PMID Year Title
26876307 2016 Epithelial membrane protein 2 regulates sphingosylphosphorylcholine-induced keratin 8 phosphorylation and reorganization: Changes of PP2A expression by interaction with alpha4 and caveolin-1 in lung cancer cells.
26592247 2015 Regulation of Eye Development by Protein Serine/Threonine Phosphatases-1 and -2A.
26575017 2016 SET antagonist enhances the chemosensitivity of non-small cell lung cancer cells by reactivating protein phosphatase 2A.
26563471 2015 Inhibition of Pten deficient Castration Resistant Prostate Cancer by Targeting of the SET - PP2A Signaling axis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26378614 2015 GBA deficiency promotes SNCA/?-synuclein accumulation through autophagic inhibition by inactivated PPP2A.
26310906 2015 Regulation of autophagy by coordinated action of mTORC1 and protein phosphatase 2A.
26234767 2015 PP2A inhibition as a novel therapeutic target in castration-resistant prostate cancer.
26053095 2015 PP2A inhibitors arrest G2/M transition through JNK/Sp1- dependent down-regulation of CDK1 and autophagy-dependent up-regulation of p21.
25979969 2015 A cell-based screening for TAZ activators identifies ethacridine, a widely used antiseptic and abortifacient, as a compound that promotes dephosphorylation of TAZ and inhibits adipogenesis in C3H10T1/2 cells.
More...