Property Summary

Ligand Count 8
NCBI Gene PubMed Count 224
PubMed Score 119.60
PubTator Score 166.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.200 1.3e-02
aldosterone-producing adenoma -1.122 1.7e-02
astrocytic glioma -1.800 3.7e-02
atypical teratoid / rhabdoid tumor -1.700 2.7e-04
Breast cancer -1.100 7.4e-34
glioblastoma -1.100 1.7e-03
hereditary spastic paraplegia -1.175 5.9e-03
lung adenocarcinoma 1.065 5.4e-07
medulloblastoma, large-cell -1.700 1.9e-05
Multiple myeloma 2.647 1.5e-04
osteosarcoma -1.246 1.5e-04
ovarian cancer -1.100 5.0e-03
psoriasis 1.100 2.3e-04
subependymal giant cell astrocytoma -1.135 1.3e-02
tuberculosis and treatment for 6 months 1.600 2.0e-05
Waldenstrons macroglobulinemia 1.151 3.9e-02

Protein-protein Interaction (1)

Gene RIF (124)

AA Sequence

MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFR      1 - 70
IGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNA     71 - 140
NVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWG    141 - 210
ISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDD    211 - 280
TLKYSFLQFDPAPRRGEPHVTRRTPDYFL                                             281 - 309
//

Text Mined References (230)

PMID Year Title